SecReT4
Protein ID: 157964600
T4SS name [ID]Tra_F [553]
Gene symboltraF
Locus tagRMA_0729
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]722212..723123 [+]
ProductF pilus assembly protein TraF
Component typeTraF_F
UniProt IDA8F1U1
KEGG IDrms:RMA_0729
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.7e-58, Aligned region: 76..292
Protein Sequence: 303 a.a.     [Download]
>gi|157964600|ref|YP_001499424.1| F pilus assembly protein TraF [Rickettsia massiliae MTU5]
MIIVLIQIYLIKIMKWLVNTITKSSLAITLLVINLWLLINDWSNHAFAGTIELDSSNKNEMIRFNVNNQF
WQRPQGFLWYNEDHVYKQEILKFSQDKKKQEPELEPYDQRIEALKKEFTRAQRQALDNPTLENVIIAQRL
HKQILEKSHKFATMWQLATILDYKLVNMDEPVNSLHKKLYEVRQEEENSKKLRFLAKNWGLILQINQGCN
YCQAFTPIVREFADKYGFQLIFVSNSETRFQGMPTIKDTGLLQTLNPENIVPVLYLVDSSGTQIYPVARG
IISEDKIAENILAVVQHHSSAAS
 
Nucleotide Sequence: 912 bp     [Download]
>gi|157964072|ref|NC_009900.1|:722212-723123 Rickettsia massiliae MTU5 chromosome, complete genome
ATAATAATTGTACTGATTCAAATTTATCTTATTAAAATAATGAAGTGGCTAGTAAACACAATAACTAAAT
CATCACTAGCCATTACATTACTAGTAATTAATTTATGGTTATTAATCAATGATTGGTCAAATCATGCATT
TGCTGGTACTATAGAGTTAGATAGTAGTAATAAAAATGAGATGATCAGGTTTAATGTAAATAATCAGTTT
TGGCAACGACCTCAAGGGTTTTTATGGTATAACGAGGATCATGTTTACAAGCAAGAAATATTAAAATTTT
CTCAAGATAAAAAAAAGCAAGAGCCAGAACTTGAGCCTTATGATCAAAGGATAGAAGCTTTAAAGAAGGA
ATTTACTAGAGCTCAGCGTCAAGCTCTTGATAATCCTACTCTTGAAAATGTTATTATTGCTCAAAGGTTA
CATAAACAAATTTTAGAAAAATCACATAAATTTGCTACCATGTGGCAACTAGCAACGATATTAGATTACA
AGCTAGTAAACATGGATGAACCAGTAAATTCCTTACATAAAAAATTATATGAAGTAAGGCAAGAAGAAGA
AAACAGCAAAAAACTAAGATTTTTAGCTAAGAATTGGGGATTAATTCTGCAAATAAATCAAGGATGCAAT
TACTGTCAGGCATTTACCCCTATTGTAAGAGAATTTGCAGATAAATATGGCTTTCAATTAATTTTTGTAA
GTAATAGTGAAACTAGATTTCAAGGGATGCCAACCATTAAAGATACCGGTTTGTTACAAACACTAAATCC
AGAAAATATTGTACCGGTATTATATTTAGTCGATAGCAGCGGCACACAAATATATCCAGTTGCACGAGGT
ATTATTAGTGAAGATAAAATCGCTGAAAATATTTTAGCAGTAGTACAGCACCACAGTAGTGCAGCATCAT
GA
 Primer design