SecReT4
Protein ID: 157964601
T4SS name [ID]Tra_F [553]
Gene symboltraH
Locus tagRMA_0730
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]723138..724478 [+]
ProductF pilus assembly protein TraH
Component typeTraH_F
UniProt IDA8F1U2
KEGG IDrms:RMA_0730
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 4.1e-89, Aligned region: 39..379
Protein Sequence: 446 a.a.     [Download]
>gi|157964601|ref|YP_001499425.1| F pilus assembly protein TraH [Rickettsia massiliae MTU5]
MIMSNDYQFRNTKFLMKQVIHIVIIVLLLQPPISYAWDLQDVFEGMSVNVTKPGTYQSQAAGYYAAGGLS
LRTNKTSFNPISIIPPSLNMSCSGIDAYLGSFSIISGEELVQLMKNIGSQAKAYAFSLGLKTFAPQIENA
LKDLRNLAMEMNQFAKGDCEMTKALFASILPKDSAMRESVCKDLQSSSGLDYFAAGKKCRSDLEQKQALA
SIQNKDPELMLTNYNIFTKAAEKAGIPENMRSAIMSMTGTIIVRDNNVYFLESLAQDEKSWIAHLKGGES
ASIYTCDNIHCLNPAIRRNITIAPDQSYQGKAKTKLDELKSKLASNNEFSNADITFLSSIGEAFPIYDYI
TLEAISGVTILDSSSELVASYSVLQHLKEVISEVRKAVTMLKSKQVADHHLNAYLKALDRVQFFARDKWS
HMLTSSDQIDRRARLIEQHLIAKEKA
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|157964072|ref|NC_009900.1|:723138-724478 Rickettsia massiliae MTU5 chromosome, complete genome
ATGATTATGAGCAATGACTATCAGTTCAGAAACACTAAGTTTCTCATGAAGCAGGTTATTCATATTGTAA
TAATAGTTTTACTTCTGCAACCACCTATTTCTTACGCATGGGATTTACAGGATGTATTTGAAGGAATGAG
CGTTAATGTCACTAAGCCTGGAACGTATCAATCTCAAGCTGCCGGCTATTATGCGGCAGGAGGATTATCC
TTGCGAACTAATAAGACATCTTTTAATCCCATTTCTATAATTCCTCCCTCATTAAACATGAGCTGTAGTG
GTATAGATGCTTATCTTGGTAGTTTTTCGATTATTTCAGGTGAAGAGCTGGTACAGCTGATGAAAAATAT
TGGCTCGCAAGCAAAAGCTTATGCATTTTCATTGGGTCTTAAGACCTTTGCTCCACAAATAGAAAATGCC
TTAAAAGATTTAAGAAATCTTGCTATGGAAATGAATCAATTTGCTAAGGGAGATTGTGAAATGACTAAGG
CTCTTTTTGCTTCCATTTTGCCTAAAGATTCAGCAATGAGAGAATCAGTTTGTAAAGATTTACAATCCAG
CTCTGGTTTGGATTATTTTGCTGCCGGCAAAAAATGTCGTAGTGATTTAGAGCAAAAGCAAGCTTTAGCC
AGCATCCAAAATAAAGATCCAGAATTAATGCTGACAAATTATAATATCTTTACTAAAGCAGCAGAAAAAG
CAGGCATCCCTGAAAATATGAGAAGTGCCATTATGTCAATGACAGGCACTATTATAGTTAGAGATAATAA
TGTTTATTTCCTTGAGTCACTTGCTCAAGATGAAAAGAGCTGGATTGCTCATTTAAAAGGCGGCGAATCT
GCCTCAATTTATACTTGTGATAATATTCATTGTTTAAATCCAGCAATAAGACGTAATATTACTATTGCTC
CAGATCAATCATATCAAGGCAAGGCTAAAACAAAACTAGATGAATTAAAGAGTAAACTGGCAAGCAACAA
TGAGTTTAGTAATGCCGATATTACTTTCTTATCTTCAATAGGGGAAGCATTTCCAATATATGATTATATT
ACTTTAGAGGCAATATCTGGAGTAACTATTTTAGATAGTTCTTCAGAATTAGTTGCCAGTTATAGTGTGC
TGCAGCATTTAAAGGAGGTAATCTCAGAGGTCAGAAAAGCAGTTACCATGCTCAAATCAAAGCAAGTAGC
AGATCATCATTTAAACGCCTACTTAAAAGCTTTAGATCGAGTGCAATTTTTTGCCAGAGATAAATGGAGT
CATATGTTAACTAGTAGCGATCAGATTGATAGAAGAGCAAGATTAATAGAGCAACATTTAATCGCCAAAG
AGAAGGCTTAA
 Primer design