SecReT4
Protein ID: 157964602
T4SS name [ID]Tra_F [553]
Gene symboltraG
Locus tagRMA_0731
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]724557..727286 [+]
Productconjugative transfer protein TraG
Component typeTraG_F
UniProt IDA8F1U3
KEGG IDrms:RMA_0731
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3e-102, Aligned region: 6..463
Protein Sequence: 909 a.a.     [Download]
>gi|157964602|ref|YP_001499426.1| conjugative transfer protein TraG [Rickettsia massiliae MTU5]
MADYVIHTFGGGDILWQVFNGIGRVFSSNSEYFTPVGKFALTIGGIWAATRAIFRGNIGIFAMEWFFPSF
FIFVFLFAPKANVWLKDEISMQAPVKIDNIPVGVAFFASISSKISYSLSETLEKHLLPPDEGLSSRKNGI
MFGAKAIGKIKDIQIEDPVTLTNSKEFLRQCFMKPYIIGNILGKKAEAQRASDIIVFIEQNMPNNFGIYY
KDPSSSAISFKTCKQVTPLIKAAINKELNDGLLTQFANGIGITSDRQEILASRLKTMTSDTLKYLKKEQT
DIHQWMRQAMLLNANREAYDDLREKFSLSRIYPQLVSMNATRGLFQQSFSYLVAGEMAANIMPILQSVFF
ALVICLIFVVFPMSMLPGGYTIFKTWITLIIWVTSWPVFFTVIHCLGMISLAGKSGTSHFTGLNILSQGS
FSEILLHEFATFQMLAASVPMLSWAVLKACAHATTTLANQFSPVPVASSIGTNIADNNLSIDNYSIGNRT
IAQQNLTPTLQLAGGIIDDGGMRVTSTDNGRQVLTQAVDSLVNNYRSSKLLQDSYQSQFMSSQSYLDSLN
DRYSDLTTTGNSIATEIGKRLSYEEAKSIGITDSQYLALQQMNSDSTSATDHTGSSNRKGTSTSATGSIG
VNTMFGSGMTTVGSSNTLDQDQGKSVNQQQSYNEALSKIKSATKDGRLSNANSNVQSLSNNLNSNFSEQQ
SVGQEIAQTKQNMQQLSYNMNYIAQNSASIDRNLNEPVLNSIIAKNIPGVSSKEQAAMWASTHQQEAEQI
ALDIAKINNTIPQNLSSESSINIPSKESLRSSFDENKQRLNDQAAISSIDDRRNDIYDKNIEQMLINNVD
NNEIEKVKILEQLSDKVKDKREQIEDEFNKTPESTIVRTGEQIADNIGISDKAIKKRNRKLLDYKNKNN
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|157964072|ref|NC_009900.1|:724557-727286 Rickettsia massiliae MTU5 chromosome, complete genome
ATGGCAGATTACGTAATACATACATTTGGTGGAGGAGATATATTATGGCAAGTTTTTAATGGCATAGGAA
GAGTATTTAGCTCAAATAGTGAGTATTTTACACCGGTAGGTAAATTTGCATTGACAATTGGTGGAATTTG
GGCAGCAACAAGAGCTATTTTTAGAGGCAATATTGGTATTTTTGCTATGGAGTGGTTTTTTCCATCTTTT
TTTATTTTTGTATTTTTATTTGCTCCAAAAGCAAATGTGTGGCTTAAGGATGAAATATCAATGCAGGCTC
CTGTGAAAATTGATAATATTCCAGTAGGTGTTGCTTTTTTTGCTTCTATATCATCAAAAATAAGTTATTC
CTTATCAGAAACGCTAGAAAAGCATTTACTGCCACCTGATGAAGGTTTATCTAGCAGAAAGAATGGGATT
ATGTTTGGAGCAAAAGCTATCGGTAAAATCAAGGATATTCAAATAGAGGATCCAGTAACTTTGACCAACT
CAAAAGAATTTTTAAGACAATGCTTTATGAAACCTTATATAATTGGTAATATTTTAGGTAAAAAAGCAGA
AGCACAAAGAGCTAGTGATATCATTGTGTTTATCGAACAAAATATGCCCAATAATTTTGGTATTTATTAT
AAGGATCCAAGCAGCTCTGCTATTTCTTTTAAAACCTGCAAACAAGTAACTCCTTTAATTAAGGCAGCTA
TTAATAAAGAATTAAATGATGGCTTGTTAACTCAATTTGCAAATGGCATAGGGATTACCTCTGATAGGCA
AGAGATATTAGCGAGTAGATTAAAAACTATGACCTCTGACACTCTAAAATATCTGAAAAAAGAACAGACA
GATATTCATCAGTGGATGAGGCAAGCAATGTTACTTAATGCTAATCGTGAAGCTTATGATGACTTGCGAG
AAAAATTCTCACTTTCTAGAATATATCCTCAGTTAGTTAGTATGAATGCTACCCGCGGATTATTTCAGCA
ATCATTTTCTTATCTGGTTGCAGGAGAGATGGCAGCAAATATAATGCCTATCTTACAATCAGTATTTTTT
GCCTTGGTGATTTGTCTGATTTTCGTAGTATTTCCAATGTCGATGCTGCCGGGCGGTTATACTATCTTTA
AGACCTGGATAACCTTGATTATTTGGGTAACTAGCTGGCCGGTATTTTTTACGGTGATTCATTGTTTAGG
GATGATTAGCCTAGCTGGTAAATCTGGCACGAGTCACTTTACCGGTTTAAATATCTTATCGCAAGGGAGT
TTTTCAGAAATTCTGTTGCATGAGTTTGCAACATTTCAGATGTTAGCAGCTTCAGTTCCGATGTTATCCT
GGGCAGTATTAAAGGCGTGTGCTCATGCAACAACAACATTAGCCAATCAATTTTCTCCAGTACCTGTTGC
AAGTAGTATTGGCACTAATATTGCTGATAATAACCTCTCTATAGATAATTATAGCATCGGTAATAGAACA
ATTGCCCAGCAAAATCTTACCCCAACGCTGCAATTGGCAGGAGGAATTATTGATGATGGTGGAATGAGAG
TGACTAGCACCGATAACGGCAGACAAGTGCTGACTCAAGCAGTAGACTCACTTGTTAACAATTACCGCTC
CTCTAAATTATTGCAAGATAGTTATCAATCTCAGTTTATGAGCTCACAAAGTTATCTTGATTCATTAAAT
GATAGATATAGTGATTTAACTACTACAGGAAATTCCATAGCAACTGAAATAGGCAAAAGATTAAGCTATG
AGGAAGCAAAATCTATAGGTATTACTGATAGCCAGTATCTAGCCTTGCAGCAGATGAATTCAGACAGCAC
ATCTGCTACTGATCATACTGGTAGTAGTAATAGAAAAGGCACTAGTACTAGTGCTACAGGAAGTATTGGC
GTGAACACTATGTTTGGCAGCGGCATGACTACTGTTGGATCAAGTAATACACTAGATCAAGATCAGGGAA
AATCAGTCAATCAGCAACAATCATATAATGAAGCATTATCTAAGATTAAGAGTGCTACTAAAGATGGCAG
ATTAAGTAATGCAAATAGTAACGTGCAATCGCTTAGTAATAATCTAAATAGTAATTTTTCTGAACAACAA
TCTGTAGGGCAAGAAATAGCACAAACTAAACAAAATATGCAGCAGCTAAGCTATAATATGAATTATATAG
CACAAAATTCTGCTTCTATTGATCGTAATTTAAATGAACCGGTATTAAATAGCATCATTGCCAAAAATAT
TCCTGGCGTAAGTAGTAAAGAGCAGGCTGCTATGTGGGCGAGTACTCACCAACAAGAAGCTGAACAAATA
GCTTTAGATATAGCTAAAATTAATAATACTATACCGCAGAATTTAAGTTCTGAAAGTAGCATCAATATTC
CATCTAAAGAAAGCTTGCGATCAAGTTTTGATGAAAATAAACAACGATTAAATGATCAAGCTGCTATTAG
TAGTATTGATGACAGAAGAAATGATATTTACGATAAAAATATAGAACAAATGCTAATTAATAATGTAGAT
AATAATGAAATAGAAAAAGTAAAGATTCTTGAGCAGTTATCTGATAAAGTAAAAGATAAGAGGGAACAAA
TTGAAGATGAATTTAATAAAACTCCTGAATCAACGATTGTCAGAACTGGTGAGCAAATAGCAGATAATAT
TGGCATTAGCGATAAGGCGATAAAGAAAAGAAATAGAAAATTACTAGATTACAAAAATAAAAATAATTAA
 Primer design