SecReT4
Protein ID: 157964604
T4SS name [ID]Tra_F [553]
Gene symboltraD_F
Locus tagRMA_0733
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]728456..730162 [+]
Productputative conjugative transfer protein TraD
Component typeTraD_F
UniProt IDA8F1U5
KEGG IDrms:RMA_0733
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.7e-135, Aligned region: 186..564
TraD_N [PF12615], Evalue: 9.7e-23, Aligned region: 33..142
TraG-D_C [PF12696], Evalue: 4.5e-21, Aligned region: 424..546
T4SS-DNA_transf [PF02534], Evalue: 1.1e-18, Aligned region: 324..560
AAA_10 [PF12846], Evalue: 1.2e-13, Aligned region: 200..240
AAA_10 [PF12846], Evalue: 1.2e-13, Aligned region: 404..495
DUF87 [PF01935], Evalue: 7.5e-07, Aligned region: 199..253
T2SE [PF00437], Evalue: 5.9e-06, Aligned region: 197..233
Protein Sequence: 568 a.a.     [Download]
>gi|157964604|ref|YP_001499428.1| putative conjugative transfer protein TraD [Rickettsia massiliae MTU5]
MICNSMQPQNQNNFTRGSQIFAHQMRMLGQGSINALTVGLVFIVSWLIWQVFQKLSLISLYYFIIERYVQ
LKLAIGEYFYSIDQIGIQFYYLEQKAWVYRNAEEFVHKFWHVTPHSHNINQFEQFLLHSAWQEGIITFTV
GIFTAIIFFMYRGKKAVIQDKIRGADFVEAGILAKMLYKNNQAANICFSGLPLVKNSERRHILITGTTGS
GKTNMLNELLPQIRKEGGRAIIVDLTGSFTDRFFDPKCDKILNPLQENSSAWLPWNDCHEIWDYNDMASN
FSNYNPKLDDFFAKSAELVLAEGLRLYQDSKDIKKLINTILYANNKEFVRIFKNSAVAGIISSSAPETSS
GIQATVSKNIEALQHLKPDGSFSIRKWFTADKGWLFITSTPNQRVMLRPLIAAWISIAIKALMNRNINNT
HSNMWFVIDELPALQKISSLPIALAESRKYGGCVVAGMQNIYQLEEIYGSAGAASMLDLFGSKFIFRVSD
QQTAHKSALMLGEQEIIETQENLSYGANSMRDGINMHSLEKRKLLVMPSEIMNLPDLTCYVKLVGNFPIT
KLKMNLQS
 
Nucleotide Sequence: 1707 bp     [Download]
>gi|157964072|ref|NC_009900.1|:728456-730162 Rickettsia massiliae MTU5 chromosome, complete genome
ATAATTTGTAATTCTATGCAACCACAAAATCAAAATAATTTTACTCGTGGTTCACAAATTTTTGCTCATC
AAATGAGAATGCTTGGGCAAGGCAGTATTAATGCTTTAACAGTTGGATTGGTATTTATTGTATCTTGGCT
AATATGGCAAGTATTTCAGAAATTATCTTTGATAAGTCTATATTATTTTATCATAGAGCGATACGTACAA
TTAAAACTTGCTATAGGAGAATATTTTTATTCTATAGATCAAATAGGTATTCAATTCTATTATTTAGAGC
AAAAAGCTTGGGTTTACCGTAATGCTGAAGAATTTGTTCATAAATTTTGGCATGTTACACCGCATTCGCA
TAATATCAATCAATTTGAGCAATTTTTATTGCATTCAGCTTGGCAAGAAGGTATTATTACTTTTACTGTG
GGAATATTTACTGCTATCATCTTTTTTATGTATCGAGGTAAAAAAGCTGTTATCCAAGATAAGATTAGGG
GAGCAGATTTTGTCGAAGCAGGTATTTTAGCAAAAATGCTTTATAAAAACAACCAAGCTGCTAATATTTG
CTTTTCTGGATTGCCATTAGTTAAAAATAGTGAAAGGAGACATATTCTTATTACCGGTACTACGGGTAGC
GGTAAAACTAACATGTTAAATGAGCTATTACCTCAGATTAGAAAAGAGGGTGGTAGAGCAATTATTGTTG
ATTTAACAGGTAGCTTTACTGATAGATTTTTTGATCCAAAATGTGATAAGATACTTAATCCTTTGCAAGA
GAATAGTTCAGCATGGCTACCATGGAATGATTGTCATGAAATTTGGGATTATAATGATATGGCAAGTAAC
TTTAGTAATTATAATCCAAAATTAGATGATTTTTTTGCTAAAAGTGCTGAGTTGGTACTGGCTGAAGGAT
TAAGATTATATCAGGATAGTAAAGATATCAAAAAGCTAATAAATACTATTCTTTATGCAAATAATAAGGA
ATTTGTTAGGATCTTTAAAAACAGTGCAGTAGCCGGTATAATTAGCAGTAGTGCCCCTGAGACATCTTCA
GGTATTCAAGCAACTGTTAGTAAAAATATTGAAGCTCTGCAACATTTAAAGCCTGATGGTAGTTTTAGTA
TTAGAAAGTGGTTTACTGCGGACAAGGGTTGGTTATTTATAACTAGTACTCCTAATCAAAGAGTAATGCT
ACGACCACTTATTGCTGCATGGATTAGCATAGCGATAAAAGCATTAATGAATAGGAACATCAATAATACT
CATAGTAATATGTGGTTTGTGATTGATGAGCTACCAGCACTGCAAAAGATATCTTCACTCCCTATAGCTT
TAGCTGAAAGCAGGAAATATGGTGGCTGCGTTGTTGCAGGTATGCAAAACATTTATCAATTAGAGGAGAT
ATATGGTTCTGCTGGAGCAGCTTCAATGCTTGATCTATTTGGCAGTAAATTTATCTTTCGAGTAAGTGAT
CAGCAGACAGCACATAAATCAGCTTTAATGCTTGGTGAGCAAGAAATAATCGAGACTCAAGAGAATCTCT
CTTATGGTGCTAACTCTATGCGTGATGGAATAAATATGCATAGCTTAGAGAAAAGAAAATTATTAGTCAT
GCCATCTGAAATCATGAATCTACCAGATCTTACCTGCTATGTAAAACTTGTGGGTAATTTCCCGATTACC
AAACTCAAAATGAATTTACAGAGTTGA
 Primer design