SecReT4
Protein ID: 157964606
T4SS name [ID]Tra_F [553]
Gene symboltraA_Ti
Locus tagRMA_0735
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]731479..735615 [-]
Productconjugal transfer protein TraA
Component typeTraI_F
UniProt IDA8F1U7
KEGG IDrms:RMA_0735
PDB IDNA
Domain hit(s) vs Pfam AAA_30 [PF13604], Evalue: 7.3e-48, Aligned region: 344..530
MobA_MobL [PF03389], Evalue: 6.9e-29, Aligned region: 18..208
Toprim_3 [PF13362], Evalue: 3.5e-18, Aligned region: 1097..1190
Viral_helicase1 [PF01443], Evalue: 1.1e-10, Aligned region: 365..480
UvrD_C_2 [PF13538], Evalue: 3.7e-08, Aligned region: 602..689
AAA_19 [PF13245], Evalue: 5.2e-06, Aligned region: 360..406
Protein Sequence: 1378 a.a.     [Download]
>gi|157964606|ref|YP_001499430.1| conjugal transfer protein TraA [Rickettsia massiliae MTU5]
MAIQFARIEIVSRSEGKNACLKAAYNARLIIKDERTNVTYNFSKKGDNVYHAVLLPSHVDQKFKNPSILM
NEVEKSEKRKNSQLLKDIVIALPDDKELDLEDRIAITHEIIEEMGWVRNGLGVQVDIHQPHDGEKNWHAH
LLVTTRRFTENGKELGAKAVDLNPKFAKVKGKAFIIPEDQIIHERAKEVINKYFAKLGLEIRVDPISFSP
EQHVGPTRMRSIINEIAEQNKICKLAHLEIIKGADGVLNRIIRHQAIFTKLDIEKAVKEIKEEAAKQKLI
REILNSDRLVKLYNEDGTDTKYYTTQDIRDEELRIVRIADKVNNQIHFNNVVKLKSAIDNLASVNEAQRE
SLQHILINSQGIRILQGRAGTGKSQVLAEAYKIATNHGQNIIGLAPTHKAASELKSKGYQQCHTVKGFLF
KLYNGKANLPRNSLLVVDEAGMVGNSDYLELLKVARSNNCNLILAGDERQLTSVERGGMFAVLASKFGSY
ELSNIRRQSKVWAREMASCFARSDITGGLHLLEQHNCLKSDHTLEESMARLIEDWSNSKFALNERLIITM
CNIEVDSINQGIRELLKAKGLLTGKEYRRYLPSQQYEDYMAGDRILFKSTNKDLQIENGEFAMITLVSND
KFVAKTDSGKEIEFNPQDISFKHGYASTVYKAQGASIKDVYVLHNLAGNSRNSYVAMTRHIEEVKFYYNR
KANRNMASLISQLSKIDNRLSSINFKTLEELVAIQDQKNKSPNIIDKVGNWFKGVVEDINDRLHSNDNYY
HLRISSRPPAKVAEILRSTSTNLATSHKAQEERKSSSYNLTNCNKQDTTISVKLQEDIMAKTKIDYNSIN
KQEALELKQRLSFKAEEIGRNLLGSPNKHLSNSQVLRWEKDGKIVMRIGGSKAGRWYDFSKGEGGDLFTL
VQREKNCDFVEAKKYLQNMVGVSNNSKLLEDKIKEQFDQKVKNQDQQAKYTEISKIKRAISLYEKSDSII
YMTPNNIAKRYLSEHRGIKKILTGYQLNNDLRTNMMWDSNSKQYYPALIAFARNKDGNITGGQSIYLNKD
TNNKADIEVNKRSFGRIRGSFVEISKNNEQQNVQSSKDGNNSASNVTIIAEGLETTLSIAEAGIKGKILC
SLGVSNIRNYEPIKGERIIITADNDGKDAVSVHTVMKAQEELISKGAVVSIIRPPEEGDFNDMLKSQGAE
SINNLIEPEIAKLTAASKVTELKSSLKASDDRKSQFQSIELLFSKLANNDNNGLNNLQQQQIKALAKFGT
AENIDTALQIYREKGIDSCTAYSNKICIAAIEKKIQKDLQIMQNKFDPNYNLGDKRFSDIVVYDFQGKSH
LVPEDYLNAIGKDKQVMQYINQASEIAKEIRNAVKQVSELKLSQGIRV
 
Nucleotide Sequence: 4137 bp     [Download]
>gi|157964072|ref|NC_009900.1|:c735615-731479 Rickettsia massiliae MTU5 chromosome, complete genome
ATGGCGATACAGTTTGCAAGAATAGAAATAGTAAGTAGGAGTGAAGGTAAAAATGCTTGTTTGAAAGCTG
CCTATAATGCCAGGCTGATTATTAAAGATGAAAGAACTAACGTTACTTATAATTTTAGCAAAAAAGGCGA
TAATGTTTACCATGCAGTATTATTACCTAGCCACGTAGATCAGAAATTCAAAAATCCAAGTATCTTGATG
AATGAAGTGGAAAAGAGTGAGAAAAGAAAAAATAGTCAATTATTAAAAGATATTGTGATAGCACTACCTG
ATGATAAAGAATTGGATTTAGAGGATAGAATAGCAATTACTCATGAAATCATTGAAGAGATGGGATGGGT
AAGAAATGGTCTAGGAGTTCAGGTTGATATTCATCAGCCACATGACGGAGAGAAGAATTGGCATGCCCAT
CTGCTTGTTACCACTAGAAGATTTACAGAAAACGGTAAAGAGTTAGGAGCTAAGGCAGTAGATTTAAATC
CTAAATTTGCCAAAGTTAAGGGTAAAGCATTTATTATCCCAGAAGATCAGATAATTCATGAGAGAGCTAA
AGAAGTAATAAATAAATATTTTGCTAAGTTAGGTTTAGAAATCAGAGTAGACCCGATAAGCTTTAGCCCT
GAGCAGCATGTCGGCCCTACTAGAATGAGAAGTATTATCAATGAAATAGCAGAGCAAAATAAAATATGTA
AGTTAGCCCATCTTGAAATTATCAAAGGAGCAGATGGAGTATTAAATCGTATTATTCGTCATCAAGCTAT
TTTTACTAAATTGGATATAGAAAAAGCAGTAAAAGAGATTAAAGAAGAAGCAGCAAAGCAAAAACTAATA
AGGGAAATATTAAATTCAGATAGGCTGGTAAAACTATATAATGAAGATGGCACTGATACTAAATACTATA
CTACTCAAGACATAAGGGATGAAGAATTAAGGATAGTTAGAATAGCAGATAAGGTAAATAACCAGATTCA
TTTTAATAACGTTGTTAAACTTAAAAGTGCTATCGACAACCTAGCTAGTGTTAATGAAGCACAAAGAGAA
AGCTTACAACATATTTTAATTAATAGCCAAGGGATTAGGATCTTGCAAGGTAGAGCCGGCACCGGTAAGT
CACAAGTACTTGCTGAAGCTTATAAAATTGCCACTAACCATGGGCAAAATATTATAGGACTCGCTCCTAC
TCATAAAGCAGCATCGGAGCTTAAAAGTAAAGGTTACCAGCAATGTCATACAGTAAAAGGGTTTTTGTTT
AAATTGTATAATGGTAAAGCTAATCTACCAAGAAACAGCCTGCTCGTAGTAGATGAAGCAGGGATGGTAG
GTAATAGTGATTATTTAGAATTACTAAAAGTAGCAAGGAGTAATAATTGTAATCTGATACTGGCTGGAGA
TGAGAGACAACTAACTTCCGTTGAGCGAGGAGGAATGTTTGCAGTATTAGCTAGTAAATTTGGCTCATAT
GAATTAAGTAACATTAGAAGACAAAGTAAAGTGTGGGCAAGAGAAATGGCTTCATGCTTTGCAAGATCAG
ATATTACTGGTGGTTTGCATTTACTAGAACAACATAACTGTTTAAAGAGTGATCATACACTAGAAGAATC
AATGGCAAGATTAATTGAGGATTGGAGTAATAGCAAATTTGCTCTAAATGAGCGTTTAATAATTACCATG
TGTAATATTGAAGTAGATAGTATTAATCAAGGGATCAGGGAGTTACTAAAAGCTAAAGGCTTGCTTACCG
GTAAAGAGTATAGACGCTATCTACCATCTCAGCAGTATGAAGATTATATGGCAGGAGATCGTATTTTGTT
TAAAAGTACTAATAAAGATTTACAAATAGAAAATGGTGAATTTGCCATGATAACTCTCGTCAGTAACGAT
AAGTTTGTTGCTAAAACAGATAGCGGGAAAGAAATAGAATTTAATCCTCAAGATATAAGCTTTAAACATG
GCTATGCTTCTACAGTGTATAAAGCACAAGGAGCCTCAATTAAAGATGTCTATGTATTACATAATCTAGC
AGGAAATAGCAGAAATTCTTATGTAGCCATGACAAGACACATAGAAGAAGTAAAATTTTATTATAATAGG
AAGGCTAACAGGAATATGGCCAGTTTAATATCGCAACTTAGTAAAATAGATAATAGGCTATCTAGCATTA
ATTTTAAAACTTTAGAAGAATTGGTAGCGATTCAAGATCAAAAAAATAAGAGTCCTAATATTATAGATAA
AGTAGGTAATTGGTTTAAAGGGGTAGTAGAAGATATTAATGATAGATTACACAGTAATGATAATTATTAC
CACTTAAGAATAAGCTCAAGACCACCTGCTAAAGTAGCAGAAATCCTAAGAAGCACTAGCACAAATCTTG
CCACAAGCCATAAAGCCCAAGAAGAGCGAAAAAGCTCTTCTTATAACCTTACGAATTGTAATAAACAAGA
TACAACAATAAGTGTTAAATTACAAGAGGATATTATGGCAAAGACAAAAATAGATTATAATTCTATTAAT
AAACAAGAAGCACTGGAATTAAAGCAACGATTATCATTTAAAGCGGAAGAAATAGGTAGAAATTTGCTAG
GCAGTCCAAATAAGCATTTATCAAATAGTCAAGTACTCCGCTGGGAGAAAGATGGCAAAATAGTGATGAG
GATAGGTGGCAGTAAAGCTGGCAGATGGTATGATTTTAGTAAAGGAGAGGGAGGAGATCTATTTACCTTA
GTACAAAGAGAAAAAAATTGTGATTTTGTAGAAGCTAAGAAATATTTACAAAATATGGTTGGTGTGTCAA
ACAATAGCAAGTTATTAGAAGATAAGATAAAAGAGCAATTTGACCAAAAAGTTAAGAATCAAGATCAACA
AGCGAAATATACTGAAATATCTAAGATAAAGAGAGCTATAAGCTTATATGAAAAATCAGATTCTATAATC
TATATGACGCCAAATAATATAGCAAAAAGATATTTATCAGAACATCGTGGAATTAAAAAAATATTAACAG
GATATCAACTAAATAATGATCTTAGAACCAATATGATGTGGGACAGTAATAGCAAACAATATTATCCTGC
ATTAATTGCTTTTGCTAGAAATAAAGATGGTAATATTACCGGTGGACAATCAATTTATTTAAACAAAGAC
ACAAATAATAAAGCTGATATTGAGGTTAATAAACGTTCATTTGGCAGAATCAGAGGTTCTTTTGTTGAGA
TTAGTAAAAATAATGAACAGCAGAACGTACAAAGCAGTAAAGATGGCAACAATTCAGCAAGTAATGTAAC
GATTATAGCAGAAGGGCTCGAGACAACTTTAAGCATTGCAGAAGCTGGTATTAAAGGCAAAATTCTTTGT
AGTTTAGGTGTAAGTAACATTAGGAACTATGAGCCTATCAAAGGAGAAAGAATAATAATTACTGCTGATA
ATGATGGCAAAGATGCAGTATCAGTTCACACTGTAATGAAAGCTCAGGAAGAATTAATTAGCAAAGGAGC
TGTGGTATCAATAATACGACCACCAGAAGAAGGCGATTTTAACGATATGTTAAAATCCCAAGGAGCAGAA
TCTATAAACAATCTTATAGAGCCTGAAATAGCAAAATTAACAGCAGCTAGCAAAGTAACAGAACTTAAAT
CATCCTTAAAAGCAAGTGATGATAGAAAATCACAATTTCAGTCTATAGAATTATTATTTTCAAAATTGGC
AAATAACGATAATAACGGACTAAATAATTTGCAGCAACAGCAAATAAAAGCTCTAGCAAAGTTTGGCACA
GCAGAAAATATTGATACTGCTTTACAAATCTACAGAGAAAAAGGTATAGATTCTTGTACTGCTTATAGTA
ACAAGATTTGCATAGCAGCAATAGAGAAGAAGATACAGAAGGATTTACAAATTATGCAGAATAAATTTGA
TCCTAATTATAATCTTGGTGATAAAAGATTTTCTGATATAGTAGTATATGATTTTCAAGGCAAAAGCCAT
CTTGTACCTGAAGATTACTTAAATGCCATAGGAAAAGATAAACAAGTAATGCAATATATAAATCAAGCTT
CCGAAATAGCTAAAGAAATAAGAAATGCAGTAAAGCAAGTATCTGAGCTCAAGCTTAGTCAAGGAATAAG
AGTTTAG
 Primer design