SecReT4
Protein ID: 15838640
T4SS name [ID]Trb [232]
Gene symbol-
Locus tagXF2046
StrainXylella fastidiosa 9a5c
Repliconchromosome [GenBank: NC_002488] [Browse all T4SS(s) in this replicon]
Location [Strand]1948438..1949832 [-]
Productconjugal transfer protein
Component typeTrbL
UniProt IDQ9P9Q6
KEGG IDxfa:XF2046, xfa:XFa0037
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.2e-31, Aligned region: 64..278
Protein Sequence: 464 a.a.     [Download]
>gi|15838640|ref|NP_299328.1| conjugal transfer protein [Xylella fastidiosa 9a5c]
MKRIPVMPVLALALLLFAAQAQAQAPVDSVGLFDNILGRFHQVADTWSGEIVRYASWLFWSLALLSMVWT
YGMMALRKADIQEFLAETIRFFAVMGFFWWLLINAPAMSTAIIDSLRQIAANATGLGNTLSPSGIVDIGF
DITSKVIDDSSIRSPVNSAVGIIASTVILIVLALIGVNMLLLLVSGWLLSYGAVFLLGFGGGRWTSDIAI
SYYKTVIGLGMQLFAMILIIGIGKSFIDQYYAAVSTGAITMKALLVMLVASIVLLALVNKIPPMFASIVG
GGGATAGIGNFGAGAAIAAAATGAAVAATAGSALAAGLSSAGGGVSALKAAFQSAQQNMASGGGSGSGSG
SGGNSAGVSSGGSSSFMSAMGTTGRFAADMGTSLAKGVGQVAKDKAGSVIASAKERVADTTGGKVASAIR
NSMDAASGQNDFKGDSLAGAAQRGSETAMNDEVAAFVNKGKQHE
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|57014152|ref|NC_002488.3|:c1949832-1948438 Xylella fastidiosa 9a5c chromosome, complete genome
ATGAAGAGGATTCCTGTAATGCCAGTGCTTGCATTGGCGTTATTGCTCTTTGCCGCACAAGCGCAAGCAC
AAGCACCTGTCGATAGCGTCGGTCTGTTTGACAACATTCTCGGACGTTTCCATCAGGTCGCTGATACTTG
GTCTGGTGAGATCGTCAGATACGCGAGCTGGCTGTTTTGGAGCTTAGCACTGCTAAGTATGGTCTGGACC
TATGGAATGATGGCCTTACGTAAGGCTGACATTCAGGAGTTTCTTGCCGAGACGATCCGGTTCTTTGCGG
TAATGGGCTTCTTCTGGTGGCTCCTGATCAACGCTCCAGCTATGTCGACGGCGATCATCGATTCGCTGCG
GCAAATTGCGGCCAACGCTACGGGATTAGGTAACACGCTCTCGCCATCCGGTATTGTCGATATCGGCTTT
GACATTACCTCAAAGGTTATTGACGATAGCTCCATCCGGTCGCCTGTTAACTCTGCCGTTGGCATCATCG
CTTCGACTGTGATTCTTATTGTGCTGGCTCTCATTGGCGTGAACATGCTACTGCTGCTCGTGTCGGGGTG
GCTGCTGTCCTATGGAGCGGTTTTCCTATTGGGATTCGGTGGTGGCCGGTGGACCTCGGACATTGCAATT
AGCTACTACAAGACGGTGATCGGCCTCGGTATGCAGCTATTTGCAATGATCTTGATTATTGGCATTGGCA
AGTCGTTCATCGACCAGTATTACGCGGCTGTATCGACCGGTGCGATCACAATGAAGGCGCTTTTGGTCAT
GCTCGTGGCGTCCATCGTTTTGCTTGCGTTGGTGAACAAGATTCCTCCGATGTTCGCAAGCATCGTAGGC
GGTGGTGGCGCTACGGCTGGCATTGGCAACTTTGGCGCGGGTGCAGCCATTGCTGCGGCGGCTACCGGAG
CTGCTGTAGCGGCGACGGCAGGCTCTGCTCTCGCTGCTGGTTTATCAAGCGCTGGGGGGGGTGTTTCGGC
TCTCAAGGCAGCATTCCAGTCTGCCCAGCAAAACATGGCGAGCGGTGGTGGTTCTGGATCAGGTTCTGGA
TCAGGTGGAAATTCTGCTGGAGTATCCTCTGGCGGCAGTAGCAGCTTCATGTCGGCGATGGGTACAACTG
GACGCTTTGCCGCTGACATGGGAACGAGTCTTGCCAAAGGTGTTGGCCAAGTTGCTAAAGACAAGGCTGG
AAGCGTGATTGCATCCGCCAAAGAACGAGTGGCAGACACTACTGGCGGCAAGGTTGCATCCGCAATCCGT
AACAGTATGGATGCGGCATCAGGGCAGAATGACTTCAAAGGTGACAGCCTAGCAGGTGCAGCTCAGAGAG
GTTCTGAGACGGCCATGAATGATGAGGTTGCCGCCTTTGTGAACAAAGGTAAGCAGCATGAGTAA
 Primer design