SecReT4
Protein ID: 15838644
T4SS name [ID]Trb [232]
Gene symbol-
Locus tagXF2051
StrainXylella fastidiosa 9a5c
Repliconchromosome [GenBank: NC_002488] [Browse all T4SS(s) in this replicon]
Location [Strand]1952766..1953656 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ9PBT7
KEGG IDxfa:XF2051
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.5e-58, Aligned region: 71..294
Protein Sequence: 296 a.a.     [Download]
>gi|15838644|ref|NP_299332.1| conjugal transfer protein TrbG [Xylella fastidiosa 9a5c]
MQKTLIPALILGLVPMVTFAAPGTDPLADQYFSKNEPKLTAQEKAAVAIGKKWQEGQDLKPFQGSDGSIN
WPYLPGKQYPIMCAVLQVCDIALQPGENVNGTNIGDPRYHVEPAVTGSGASQIIHLILKPLDVGLDTTLV
LTTDRRTYHFRLRSSRTQLMPFVSFTYPEDAMAKWDAIKARETKVRQDNTIPHTGEYLGNLSFDYVVSGS
VRWKPVRVYNDGRKTVIEMPSKMQQSEAPALLVVHKDGSLFKDDETQMVNYRVQDARYIVDTIFDKAILV
SGVGSSQQKVTITRGN
 
Nucleotide Sequence: 891 bp     [Download]
>gi|57014152|ref|NC_002488.3|:c1953656-1952766 Xylella fastidiosa 9a5c chromosome, complete genome
ATGCAAAAGACTTTAATCCCCGCTCTGATTCTCGGTTTAGTGCCGATGGTGACATTCGCAGCTCCGGGCA
CCGACCCGTTGGCCGATCAGTATTTCTCGAAAAACGAGCCGAAGTTGACGGCGCAGGAGAAGGCGGCTGT
CGCTATCGGCAAAAAGTGGCAGGAGGGTCAGGACCTGAAGCCATTCCAAGGTTCTGATGGTTCGATCAAC
TGGCCGTACTTACCTGGCAAGCAATACCCGATCATGTGTGCTGTGCTGCAAGTCTGTGACATTGCTTTAC
AGCCAGGTGAGAACGTCAATGGCACGAACATTGGTGATCCTCGCTATCATGTTGAGCCAGCCGTCACAGG
TTCAGGTGCGTCGCAAATAATACATCTGATCTTGAAGCCTCTTGATGTGGGTCTTGATACGACGCTCGTG
CTCACCACGGATCGGCGCACGTATCACTTCCGCCTGCGTTCTAGTCGCACGCAGCTCATGCCGTTTGTAT
CGTTTACGTACCCCGAAGACGCGATGGCCAAGTGGGATGCAATCAAAGCCCGCGAAACAAAGGTACGCCA
GGACAACACTATTCCGCATACCGGTGAGTACTTGGGGAACCTCAGCTTTGATTACGTAGTGAGCGGCTCG
GTTCGCTGGAAGCCGGTTCGTGTCTACAACGATGGCCGTAAAACCGTCATCGAAATGCCTTCAAAGATGC
AACAAAGTGAAGCGCCAGCACTGCTTGTCGTCCATAAGGACGGAAGCCTGTTCAAAGATGATGAGACGCA
AATGGTGAACTATCGCGTTCAAGACGCCCGCTACATCGTAGATACGATCTTTGACAAAGCGATCCTCGTA
TCCGGCGTTGGTTCGAGTCAACAGAAGGTAACGATCACGAGGGGGAACTAA
 Primer design