SecReT4
Protein ID: 15838647
T4SS name [ID]Trb [232]
Gene symbol-
Locus tagXF2055
StrainXylella fastidiosa 9a5c
Repliconchromosome [GenBank: NC_002488] [Browse all T4SS(s) in this replicon]
Location [Strand]1957247..1957681 [-]
Productconjugal transfer protein
Component typeTrbC
UniProt IDQ9PBT4
KEGG IDxfa:XF2055
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.7e-17, Aligned region: 27..119
Protein Sequence: 144 a.a.     [Download]
>gi|15838647|ref|NP_299335.1| conjugal transfer protein [Xylella fastidiosa 9a5c]
MVAISHEISKESIEMQFTKSCINVNYRVLLILGVALLLLIATHPAFASNTAGGGLPSDEWFTRIRESVTG
PFAFTVAIVGIVAAGAGLIFGGDMNGFLRTLIFIVLVLSFLVAAQNSLSAITGQGAEITAFSHDLSNLLQ
ARLA
 
Nucleotide Sequence: 435 bp     [Download]
>gi|57014152|ref|NC_002488.3|:c1957681-1957247 Xylella fastidiosa 9a5c chromosome, complete genome
ATGGTTGCTATATCACACGAAATATCTAAGGAGAGTATAGAAATGCAGTTTACCAAGTCTTGCATCAACG
TTAATTATCGAGTGCTTCTCATCCTTGGCGTTGCGCTGCTGCTGTTGATTGCCACGCATCCGGCGTTCGC
GTCAAACACGGCTGGCGGTGGTCTACCTTCAGATGAATGGTTCACTAGAATTCGCGAGTCTGTGACAGGT
CCGTTTGCATTTACCGTAGCGATTGTTGGCATCGTTGCTGCTGGTGCAGGGCTTATTTTCGGTGGTGACA
TGAACGGCTTCTTGCGCACGCTCATCTTCATCGTCCTGGTGTTGTCCTTCTTGGTTGCCGCACAAAACAG
CCTGAGTGCGATCACGGGGCAGGGTGCTGAAATTACGGCGTTTTCGCATGATCTGAGCAATCTCTTACAA
GCCAGGCTCGCGTAA
 Primer design