SecReT4
Protein ID: 158425451
T4SS name [ID]Trb [248]
Gene symbol-
Locus tagAZC_3827
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4378667..4380658 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA8IP35
KEGG IDazc:AZC_3827
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.7e-101, Aligned region: 111..556
TraG-D_C [PF12696], Evalue: 5.6e-31, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 2.9e-29, Aligned region: 171..536
AAA_10 [PF12846], Evalue: 2.2e-06, Aligned region: 370..478
Protein Sequence: 663 a.a.     [Download]
>gi|158425451|ref|YP_001526743.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MSATKILWGQILTVPLIVLAAIWGATQYVAWSLGYQAQLGAPWFALVGLPIYYPPAFFWWWYFFDAYAPG
VFFRGALIAASGGFLSIAVAIALSVWRAREASRVETYGSARWAEREEVRAAGLLGTDGVVLGRYERDYLR
HDGPEHVLCFAPTRSGKGVGLVVPSLLTWPGSAIVHDIKGENWQLTAGFRARHGRVLLFDPTNARSAAYN
PLLEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAEKDKTLAGVAAFLSDPK
RPIETTLDAMMKTAHQGEAGPHPVIASAARELLNKSDNERSGVLSTAMSFLGLYRDPVIAEVTRRCDWRI
ADIIGGKRPSTLYLVVPPSDINRTKPLIRLLLNQIGRRLTEDLQAKAGRHRLLLMLDEFPALGRLDFFES
ALAFMAGYGLKAFLIAQSLNQIEKAYGPNNSILDNCHVRVSFATNDERTAKRVSDALGTATEMKAMKNYA
GHRLSPWLGHLMVSRSETARPLLTPGEVMQLPPTDEIVLVAGTPPIRAKKVRYYEDARLRDRLLPPPMPS
RGLTVQHDDWTALPLPRPHNGAGRGAAVEGRDDDPTGSEHRHQPELSRVKPVERSAPIENEFEFDLDRDD
EMDDVPARNRRMKGLMQGVARQVSLNPNDGMEL
 
Nucleotide Sequence: 1992 bp     [Download]
>gi|158421624|ref|NC_009937.1|:c4380658-4378667 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGTCGGCGACGAAAATCCTCTGGGGGCAGATCCTCACCGTGCCGCTGATCGTGCTGGCGGCGATCTGGG
GCGCCACACAATATGTGGCCTGGAGCCTCGGCTATCAGGCGCAGCTCGGCGCGCCGTGGTTCGCGCTTGT
CGGGCTGCCCATCTACTACCCGCCGGCCTTCTTCTGGTGGTGGTACTTTTTCGATGCCTATGCGCCGGGT
GTGTTCTTTCGCGGCGCGCTGATCGCCGCCTCTGGCGGCTTCCTCTCCATCGCCGTCGCCATCGCCCTGT
CGGTTTGGCGGGCCCGCGAGGCCTCCCGGGTCGAGACCTATGGTTCAGCGCGCTGGGCCGAGAGGGAGGA
AGTCCGGGCCGCCGGGCTGCTCGGCACCGATGGCGTTGTCCTCGGCCGGTATGAACGAGACTATCTGCGC
CATGACGGGCCGGAGCACGTGCTGTGCTTCGCGCCGACCCGGTCCGGCAAGGGCGTCGGCTTGGTCGTGC
CCTCGCTGCTGACCTGGCCGGGATCGGCCATCGTCCATGACATCAAGGGCGAGAACTGGCAGCTCACCGC
CGGCTTCCGCGCCCGGCATGGCCGTGTGCTATTGTTCGACCCGACCAATGCCAGGTCAGCCGCCTACAAT
CCGCTGCTGGAGGTGCGCCGCGGCGAATGGGAAGTGCGGGACGTCCAGAACATCGCCGACATCCTGGTAG
ATCCCGAAGGCTCGCTGGAAAAGCGAAACCACTGGGAGAAGACCAGCCACGCGCTGCTCGTCGGCGCCAT
CCTCCACGTGCTCTATGCCGAAAAGGACAAGACGCTCGCCGGCGTCGCCGCCTTCCTGTCCGATCCAAAG
CGGCCGATCGAGACCACGCTCGACGCCATGATGAAGACGGCACACCAGGGTGAGGCTGGCCCACATCCCG
TCATCGCCAGCGCCGCGCGCGAACTGCTGAACAAATCCGACAACGAGCGCTCGGGCGTGCTCTCCACCGC
CATGTCGTTCCTTGGCCTCTACCGCGATCCGGTGATTGCCGAGGTGACGCGGCGCTGCGACTGGCGCATC
GCTGACATCATCGGCGGCAAGCGACCGTCGACCCTCTACCTCGTGGTGCCGCCCTCCGACATCAATCGCA
CCAAGCCGCTGATCCGCCTGCTCCTCAACCAGATCGGCCGGCGCCTCACCGAGGACCTGCAGGCAAAGGC
CGGACGGCACCGACTGCTGCTCATGCTGGACGAGTTCCCCGCGCTCGGCCGGCTCGACTTCTTTGAATCA
GCGCTCGCCTTCATGGCCGGCTATGGCCTGAAAGCCTTCCTCATCGCCCAGTCGCTGAACCAGATCGAGA
AAGCATATGGCCCGAACAACTCCATCCTCGACAACTGCCATGTCCGCGTGAGCTTCGCCACGAACGACGA
GCGCACCGCGAAGCGCGTCTCCGATGCGCTCGGCACCGCGACCGAGATGAAGGCGATGAAGAACTATGCC
GGCCATCGGCTCTCGCCCTGGCTCGGTCACCTCATGGTGTCGCGTTCCGAGACCGCCCGCCCGTTGCTCA
CCCCCGGCGAGGTCATGCAGCTACCGCCTACGGACGAGATCGTCCTGGTCGCCGGTACCCCGCCGATCCG
CGCGAAGAAGGTGCGATACTACGAGGACGCGCGCCTCCGGGACCGGCTCCTGCCGCCGCCAATGCCCTCT
CGTGGCCTGACCGTCCAACACGATGACTGGACTGCGCTGCCGTTGCCCAGGCCCCATAACGGCGCCGGCA
GGGGCGCCGCCGTCGAAGGTCGAGACGATGACCCTACAGGCTCCGAACACCGGCATCAGCCCGAGCTCAG
CCGCGTCAAGCCGGTCGAGAGAAGCGCGCCCATCGAGAACGAGTTCGAGTTCGATCTGGATCGCGACGAC
GAGATGGACGACGTCCCCGCCCGGAACCGGCGCATGAAAGGACTGATGCAAGGCGTGGCCCGTCAGGTCA
GCCTCAATCCCAATGACGGCATGGAGTTGTGA
 Primer design