SecReT4
Protein ID: 158425453
T4SS name [ID]Trb [248]
Gene symbol-
Locus tagAZC_3829
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4382663..4383325 [-]
Productlytic transglycosylase
Component typeTrbN
UniProt IDA8IP40
KEGG IDazc:AZC_3829
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 220 a.a.     [Download]
>gi|158425453|ref|YP_001526745.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MRRSASLLAAVLSFSCVFSSIGNAQNAPPVMKASDNAYAAYIDEAAQRFELPASWIRAVMQAESSGDPHA
ASSAGAMGLMQIMPTTWNELRIHHGLGVDPFDPRDNILAGAAYLRQLHDRYGSIRAMLAAYNAGPARYEA
SLAGKPLPPETRTYIAALAPIIDNQSAAGATASVRPMTQSWREAPLFATPPERSNPVDSGFLAPRSDALF
VAPLPSRRAP
 
Nucleotide Sequence: 663 bp     [Download]
>gi|158421624|ref|NC_009937.1|:c4383325-4382663 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGCGTCGCTCCGCTTCTTTGCTCGCAGCCGTGCTGTCATTCAGCTGCGTGTTTTCCTCCATCGGCAACG
CGCAAAACGCGCCGCCGGTTATGAAGGCCTCAGACAATGCCTACGCCGCCTATATCGACGAGGCTGCGCA
GCGCTTCGAGCTTCCGGCCAGCTGGATCCGTGCAGTCATGCAAGCCGAGAGCAGCGGCGATCCGCACGCC
GCCTCATCGGCCGGTGCCATGGGGCTGATGCAGATCATGCCCACGACCTGGAACGAGCTTCGCATCCATC
ATGGTCTCGGCGTCGATCCGTTCGACCCGCGCGACAACATCCTCGCTGGCGCGGCCTATCTGCGCCAGCT
CCATGACCGCTATGGCAGCATCCGCGCCATGCTCGCGGCCTACAATGCCGGGCCGGCGCGCTATGAAGCG
TCGCTTGCCGGCAAACCGCTGCCGCCAGAGACGCGCACTTACATCGCGGCTCTGGCGCCGATCATCGACA
ATCAGTCTGCGGCCGGCGCCACCGCATCGGTGCGGCCAATGACGCAAAGCTGGCGCGAGGCTCCGCTGTT
CGCCACGCCGCCCGAGCGCAGCAATCCAGTCGATTCCGGGTTCCTCGCGCCGCGATCGGACGCGCTGTTC
GTCGCACCGTTGCCATCGCGGAGGGCGCCATGA
 Primer design