SecReT4
Protein ID: 158425454
T4SS name [ID]Trb [248]
Gene symbol-
Locus tagAZC_3830
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4383327..4383872 [-]
Productconjugal transfer protein
Component typeTraF
UniProt IDA8IP42
KEGG IDazc:AZC_3830
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 3.7e-52, Aligned region: 29..166
Protein Sequence: 181 a.a.     [Download]
>gi|158425454|ref|YP_001526746.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MNRAAYVLMAAATSVGMAYAATLPTPLKLIWNISASVPIGLYSVEPADALEITDLVVVMPPPPLAAFLIG
RGYLGEGTPLLKRVMGLPGQEVCRLHDAITVDGVPLGEALPRDRMGRDLPVWQGCRRIAPGHLFLMNPDV
GDSLDGRYFGPISDGTVIGRAMPLLTDEAGNSDFVWRAAVR
 
Nucleotide Sequence: 546 bp     [Download]
>gi|158421624|ref|NC_009937.1|:c4383872-4383327 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGAACCGCGCCGCCTATGTGCTGATGGCTGCGGCCACCAGCGTCGGCATGGCCTACGCCGCAACGCTGC
CGACGCCACTCAAGCTGATCTGGAATATCTCGGCGAGCGTCCCTATCGGGCTCTACTCGGTCGAGCCGGC
CGATGCCCTCGAGATCACCGATTTGGTCGTGGTAATGCCACCACCGCCGCTCGCCGCGTTCCTCATCGGG
CGCGGCTATCTCGGTGAGGGCACGCCGCTGTTGAAGCGCGTGATGGGGCTTCCGGGACAGGAGGTCTGCC
GCCTCCATGACGCCATCACCGTCGATGGCGTGCCGCTTGGCGAAGCGCTGCCGCGCGACCGCATGGGCCG
CGATCTGCCGGTCTGGCAGGGCTGCCGGCGTATCGCTCCCGGTCATCTGTTCCTGATGAACCCGGACGTC
GGCGACAGTCTCGACGGACGGTATTTCGGGCCGATTTCAGACGGCACCGTCATCGGCCGTGCGATGCCAC
TCCTCACGGATGAAGCCGGCAACAGTGACTTCGTCTGGCGCGCGGCGGTGCGCTGA
 Primer design