SecReT4
Protein ID: 158425482
T4SS name [ID]Trb [248]
Gene symboltrbB
Locus tagAZC_3858
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4410399..4411370 [+]
Productconjugal transfer protein
Component typeTrbB
UniProt IDA8IPC5
KEGG IDazc:AZC_3858
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.4e-85, Aligned region: 24..288
FtsK_SpoIIIE [PF01580], Evalue: 4.6e-05, Aligned region: 145..177
Protein Sequence: 323 a.a.     [Download]
>gi|158425482|ref|YP_001526774.1| trbB gene product [Azorhizobium caulinodans ORS 571]
MAAAHHHQGFARGARMLRTAMGPAIARHLEDPSVVEVMLNPDGRLWIDRLSEGLGDTGEKLSPADGERIV
RLVAHHVGAEVHAGAPRVSAELPETEERFEGLLPPVVTAPTFAIRKPAVAVFTLEDYVRAGIMSDGQAGA
LRQGVASRANILVAGGTSTGKTTLTNALLAEVAKTEDRVVLIEDTRELQCAAPNLVALRTKDGVASLSEL
VRSALRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSAIGALRRMEQLIQEAVVTVPRALIAE
TINLVAVLSGRGKARRLTELARVEGLGPDGDYRVTPVLTGDPS
 
Nucleotide Sequence: 972 bp     [Download]
>gi|158421624|ref|NC_009937.1|:4410399-4411370 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGGCGGCAGCACATCATCATCAGGGTTTTGCCCGCGGCGCGCGGATGCTGCGCACGGCGATGGGTCCGG
CGATCGCCCGGCACCTGGAAGACCCGTCCGTCGTCGAGGTGATGCTGAACCCGGATGGGCGGCTGTGGAT
CGACCGGCTCTCGGAAGGGTTGGGCGACACAGGCGAGAAGCTGTCGCCCGCTGACGGTGAACGCATCGTT
CGCCTCGTCGCGCACCATGTCGGCGCGGAGGTTCACGCTGGCGCCCCGCGCGTTTCGGCCGAGCTGCCCG
AGACAGAAGAACGGTTCGAGGGCCTGCTGCCGCCGGTCGTCACGGCACCTACTTTCGCCATCCGCAAGCC
CGCCGTCGCGGTCTTCACGCTCGAGGACTATGTCCGCGCCGGGATCATGTCCGACGGACAAGCCGGCGCG
CTGCGCCAGGGTGTGGCCTCTCGCGCCAACATTCTCGTCGCGGGCGGCACCTCGACGGGCAAGACCACGC
TGACCAACGCGCTGCTCGCCGAGGTCGCTAAGACAGAAGATCGGGTCGTTCTCATCGAGGATACGCGCGA
GCTGCAATGCGCGGCGCCGAACCTCGTCGCCCTGCGCACCAAGGACGGCGTCGCCTCGCTGTCCGAGCTC
GTCCGCTCAGCGCTGCGCCTGCGGCCCGACCGCATCCCCATTGGCGAGGTGCGCGGCGCAGAGGCGCTCG
ACCTGCTCAAGGCGTGGGGCACCGGCCATCCCGGCGGCATCGGCACCATCCATGCCGGCAGTGCTATCGG
CGCGCTGCGCCGGATGGAGCAACTCATTCAGGAAGCCGTCGTCACCGTCCCGCGCGCGCTGATCGCCGAG
ACCATCAATCTCGTGGCCGTGCTCTCGGGGCGCGGCAAGGCGCGCCGGCTCACCGAACTCGCTCGTGTCG
AGGGCCTCGGCCCTGATGGCGACTACCGCGTCACCCCTGTCCTTACCGGAGATCCCTCATGA
 Primer design