SecReT4
Protein ID: 158425483
T4SS name [ID]Trb [248]
Gene symboltrbC
Locus tagAZC_3859
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4411367..4411699 [+]
Productconjugal transfer protein
Component typeTrbC
UniProt IDA8IPC8
KEGG IDazc:AZC_3859
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.9e-24, Aligned region: 8..100
Protein Sequence: 110 a.a.     [Download]
>gi|158425483|ref|YP_001526775.1| trbC gene product [Azorhizobium caulinodans ORS 571]
MIPSLHRARSAARLALSATCISLMATASAHASGSSMPWEAPLQSILQSIEGPVAKIIAVIVIISTGLALA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|158421624|ref|NC_009937.1|:4411367-4411699 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGATCCCATCGCTCCATCGCGCACGCAGCGCCGCCCGACTGGCCCTGTCTGCCACCTGTATCAGCCTGA
TGGCCACGGCCAGCGCTCATGCCTCCGGTTCCTCCATGCCATGGGAGGCGCCGCTGCAATCCATCCTCCA
GTCGATCGAGGGGCCGGTCGCCAAGATCATCGCCGTCATCGTCATCATCTCGACCGGGCTGGCGCTGGCC
TTTGGCGACACGTCCGGTGGCTTCCGCCGGCTGATCCAGATCGTGTTCGGCCTGTCGATCGCCTTCGCCG
CATCGAGCTTCTTCCTGTCCTTCTTCTCGTTCGGCGGCGGAGCGCTCGTCTGA
 Primer design