SecReT4
Protein ID: 158425484
T4SS name [ID]Trb [248]
Gene symboltrbD
Locus tagAZC_3860
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4411699..4411968 [+]
Productconjugal transfer protein
Component typeTrbD
UniProt IDA8IPD0
KEGG IDazc:AZC_3860
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.6e-10, Aligned region: 1..80
Protein Sequence: 89 a.a.     [Download]
>gi|158425484|ref|YP_001526776.1| trbD gene product [Azorhizobium caulinodans ORS 571]
MAETVEVPGFSVPVHRALNEPILLGGAPRAIAIVNGTLAGAVGLGLRLWLVGLAIGVIGHIAAVWAAKRD
PLFVEVVRRHLRIPAHLSV
 
Nucleotide Sequence: 270 bp     [Download]
>gi|158421624|ref|NC_009937.1|:4411699-4411968 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGGCCGAGACGGTTGAGGTTCCCGGCTTCAGCGTTCCGGTCCACCGAGCACTGAATGAGCCGATCCTAC
TCGGCGGAGCACCGCGTGCCATCGCCATCGTCAATGGCACGCTCGCCGGGGCCGTGGGTCTCGGCCTGCG
CCTGTGGTTGGTCGGCCTCGCCATCGGGGTGATCGGCCATATCGCAGCAGTATGGGCGGCGAAGCGTGAT
CCGCTTTTCGTCGAGGTGGTGCGCCGGCATCTGCGCATCCCCGCGCACCTCTCGGTCTGA
 Primer design