SecReT4
Protein ID: 158425485
T4SS name [ID]Trb [248]
Gene symboltrbE
Locus tagAZC_3861
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4411982..4414420 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA8IPD3
KEGG IDazc:AZC_3861
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3e-38, Aligned region: 442..723
CagE_TrbE_VirB [PF03135], Evalue: 2.4e-14, Aligned region: 179..388
Protein Sequence: 812 a.a.     [Download]
>gi|158425485|ref|YP_001526777.1| trbE gene product [Azorhizobium caulinodans ORS 571]
MMNLAEYRRDNRRLADFLPWAALVAPGIVLNKDGSFQRTARFRGPDLDSAVPAELVAVAGRLNNAFRRLG
SGWAIFVEAQRHAAATYPASAFPDAASALVDAERRAEFEQAGSHFESSYVLTFTFLPPAEDAARTEGWLY
EGRDQAGLDPHETLRGFADRTDRILNLIDAFMPECRWLDDDEMLTYLHGCVSTQRHRVRVPETPTYLDAL
LADQPLTGGLEPRLGDQHLRVLTITGFPTVTTPGLLDELNRLAFPYRWSTRAILLDKTDAVRLLTKIRRQ
WFAKRKSIAAILKEVMTNEASVLVDSDAANKAEDADLALQELGADHAGIAYVTATVTVWDADPRIADEKL
RRVEKVIQGRDFTVMTETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGDSADAHFNAPP
LLFGKTEGSTPFRFCLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGAQVFAFDFGGSIRAAALACG
ADWHDLGGGLSEGSAETVALQPLARIDEAVEHAWAADWLNAILTREGVHITPQMKEHIWTALTSLASAPV
EERTLTGLCVLLQSNDLKQALRPYCLGGAWGRLLDAETEHLGSATVQVFETEGLIGTEAAPAVLAYLFHR
IEDRLDGSPTLIIIDEGWLALDDEAFAGQLREWLKTLRKKNASVIFATQSLSDIDGSAIAPAIIESCPTR
LLLPNERAIEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSEVALALCAASSKTDQ
QAIGRIFAAYGRDGFLDAWLRHRGLGWAADLLPNLTNLETQP
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|158421624|ref|NC_009937.1|:4411982-4414420 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGATGAACCTCGCCGAGTATCGCCGCGATAACCGGCGCCTTGCCGATTTCCTGCCCTGGGCAGCGCTCG
TCGCGCCGGGCATCGTCCTGAACAAGGATGGTTCGTTCCAGCGGACAGCGCGCTTTCGCGGACCGGACCT
CGACAGCGCCGTTCCCGCCGAGCTCGTCGCGGTAGCAGGGCGGCTGAACAACGCCTTTCGTCGCCTTGGC
TCGGGATGGGCGATCTTCGTGGAGGCGCAGCGCCATGCGGCCGCGACCTACCCGGCGAGCGCCTTTCCCG
ATGCCGCCTCCGCTCTGGTCGATGCCGAGCGGCGGGCCGAATTCGAGCAGGCGGGCAGCCATTTCGAGTC
GAGCTACGTCCTGACCTTCACCTTCCTGCCGCCGGCCGAGGATGCCGCCCGCACCGAAGGCTGGCTCTAT
GAAGGGCGGGACCAGGCAGGCCTTGATCCCCATGAGACGTTGCGCGGCTTCGCCGACCGAACTGATCGGA
TCCTCAACCTCATCGATGCCTTCATGCCGGAATGCCGCTGGCTGGACGACGACGAGATGCTGACCTATCT
GCATGGTTGTGTCTCGACACAGCGGCACCGTGTCCGCGTGCCGGAGACGCCGACCTATCTCGACGCGCTG
CTGGCCGATCAGCCGCTCACCGGCGGGCTGGAGCCGCGCCTCGGCGATCAGCACCTACGTGTGCTGACCA
TCACCGGCTTTCCCACGGTGACGACGCCCGGCCTGCTCGATGAGCTGAACCGGCTCGCCTTTCCTTATCG
CTGGTCGACCCGCGCCATCCTTCTCGACAAGACGGATGCGGTCCGGCTGCTCACCAAGATCCGCCGCCAA
TGGTTCGCCAAGCGCAAATCCATCGCCGCCATCCTGAAGGAGGTCATGACCAATGAGGCCTCCGTCCTCG
TGGACTCGGATGCCGCGAACAAGGCTGAAGATGCCGACCTCGCCCTGCAGGAGCTCGGCGCGGACCATGC
CGGCATCGCCTATGTCACCGCGACGGTGACGGTGTGGGATGCCGATCCGCGCATCGCCGACGAGAAACTG
CGACGGGTCGAGAAGGTCATCCAGGGCCGCGACTTCACGGTGATGACCGAGACCATCAATGCCGTCGATG
CCTGGCTCGGCAGCTTGCCCGGCCACGTCTATGCCAATGTCCGCCAGCCGCCGATCTCGACGCTCAATCT
CGCCCATATGATTCCGCTGTCAGCGGTGTGGGCCGGCGACAGTGCCGACGCGCATTTCAATGCCCCGCCG
CTCCTGTTCGGCAAGACCGAGGGCTCGACCCCGTTCCGGTTCTGCCTCCATGTCGGCGATGTCGGCCACA
CCCTCGTCGTCGGCCCGACCGGCGCCGGCAAATCCGTGCTGCTGGCGCTGATGGCGCTGCAGTTTCGGCG
CTACGCCGGTGCCCAGGTGTTTGCCTTTGATTTCGGCGGCTCGATCCGGGCGGCGGCGCTCGCTTGTGGG
GCGGACTGGCACGATCTCGGTGGCGGGCTCAGCGAGGGGAGCGCGGAGACTGTCGCGCTCCAGCCGCTTG
CGCGCATCGATGAAGCTGTGGAACACGCCTGGGCCGCCGACTGGCTGAACGCCATCCTCACCCGCGAAGG
CGTCCATATCACGCCGCAGATGAAGGAACATATCTGGACGGCGCTGACATCGCTCGCCTCGGCGCCGGTC
GAGGAACGCACCCTCACCGGCCTCTGCGTCCTGCTTCAGTCCAACGACCTGAAGCAGGCATTGCGTCCCT
ACTGCCTGGGCGGCGCCTGGGGCCGGCTGCTCGACGCCGAGACCGAGCATCTGGGCTCCGCCACCGTCCA
GGTTTTCGAGACTGAGGGGTTGATCGGTACGGAGGCCGCGCCTGCGGTGCTCGCCTATCTGTTCCACCGG
ATCGAGGATCGGCTCGATGGATCGCCGACCCTTATCATCATCGATGAAGGCTGGCTGGCGCTGGACGACG
AGGCCTTCGCGGGCCAACTGCGCGAATGGCTGAAGACGCTGCGCAAGAAGAACGCCAGCGTCATTTTCGC
CACGCAGTCGCTCTCCGACATCGACGGCTCGGCGATCGCACCCGCCATCATCGAGAGCTGCCCGACACGC
CTTCTGCTCCCCAATGAGCGGGCCATCGAGCCGCAGATCACCGCCATCTATCGCCGCTTCGGCCTGAACG
ATCGGCAGATCGAGATCCTCGCGCGGGCGACCCCGAAGCGCGACTACTATTGCCAGTCGCGGCGCGGCAA
CCGGCTGTTCGAGCTCGGCCTCAGTGAGGTCGCGCTGGCGCTGTGCGCGGCGTCCTCGAAGACGGACCAG
CAGGCCATCGGCAGGATATTCGCCGCGTACGGTCGCGACGGCTTCCTGGACGCTTGGCTGCGTCATCGCG
GCCTCGGCTGGGCCGCCGACCTCCTTCCCAACCTCACCAATTTGGAGACGCAGCCATGA
 Primer design