SecReT4
Protein ID: 158425488
T4SS name [ID]Trb [248]
Gene symboltrbL
Locus tagAZC_3864
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4415454..4416683 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA8IPE1
KEGG IDazc:AZC_3864
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.5e-53, Aligned region: 37..262
Protein Sequence: 409 a.a.     [Download]
>gi|158425488|ref|YP_001526780.1| trbL gene product [Azorhizobium caulinodans ORS 571]
MNGTGVIDNFLGVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWSWGADDDVIARLIKKTLFVGVF
AYIIGNWNNLARIVFESFAGLGLKGSGTAFSVSDLMRPGKVAQTGLDAGRPLLESISDLMGWIAFFENFI
QIACLLFAWALVLLSFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVMVL
AVIIGIGSTLFGQFTAGFGGQTPTIDDAMAIVLAALSLLGLGIFGPGIAAGLVSGGPQLSAGAAVGTGFA
AGGALMAAGGTASLAVRGGGAALSATAAAARGGATAYSIGAAGQSGMAGVASGLGGVARAAGSAAVSPLA
NAVSGTASASSAGDVPDWAKRMKRGQSLRHGVSAAAHAVRSGDSHAGGSSVSLNESDRS
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|158421624|ref|NC_009937.1|:4415454-4416683 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGAACGGCACCGGCGTCATCGACAACTTTCTGGGCGTCTTCACCTCCTATATTGACAGCGGCTTCGGCC
TCCTTGGTGGCGAGGTCGCTTTCATCGCCACCACGCTCATCGTCATCGACGTGACGCTGGCGGCGCTGTT
CTGGTCGTGGGGTGCGGATGACGACGTCATCGCCCGGCTCATCAAGAAGACCCTGTTCGTCGGCGTCTTC
GCCTACATCATCGGCAATTGGAACAACCTCGCCCGCATCGTCTTCGAGAGCTTCGCCGGGCTGGGGCTGA
AGGGCTCGGGAACGGCATTTTCCGTCAGCGACTTGATGCGTCCGGGCAAGGTAGCGCAGACCGGGCTCGA
TGCCGGCCGTCCCTTGCTCGAGTCCATCTCCGATCTGATGGGCTGGATCGCCTTCTTCGAGAATTTCATC
CAGATCGCCTGCCTGCTGTTTGCCTGGGCATTGGTGCTGCTCTCCTTCTTCATCCTCGCCGTCCAGCTCT
TCGTCACCCTGATCGAGTTCAAGCTGACGACGCTCGCCGGCTTCGTGCTGATCCCCTTCGGCCTGTTCGG
CAAGACCGCCTTCATGGCCGAACGGGTGCTGGGCAATGTGGTCTCCTCCGGCATCAAAGTCATGGTGCTC
GCGGTCATCATCGGCATCGGCTCGACCCTGTTCGGCCAGTTCACGGCGGGCTTCGGCGGACAGACGCCCA
CCATCGACGACGCCATGGCGATCGTGCTGGCCGCGCTATCGCTGCTCGGTCTCGGCATCTTCGGTCCCGG
CATTGCCGCCGGCCTTGTCTCCGGTGGTCCGCAGCTGAGCGCGGGGGCCGCCGTCGGCACGGGTTTCGCC
GCCGGTGGCGCCCTGATGGCGGCGGGCGGTACTGCTAGCCTCGCTGTCCGCGGCGGTGGCGCCGCGCTGT
CCGCTACGGCGGCCGCGGCGCGAGGTGGAGCGACCGCCTACAGCATCGGTGCGGCCGGCCAGTCCGGCAT
GGCGGGTGTCGCCTCAGGTCTCGGTGGCGTCGCGCGAGCCGCGGGCTCTGCCGCCGTGTCACCGCTCGCG
AACGCCGTCAGCGGTACGGCCTCAGCCTCCTCCGCCGGTGACGTGCCCGACTGGGCCAAGCGCATGAAGC
GCGGCCAGTCGCTTCGCCATGGCGTCTCCGCCGCCGCCCATGCTGTGCGCTCCGGTGACAGCCATGCCGG
CGGCTCCTCCGTCTCCCTCAATGAGAGCGACCGCTCATGA
 Primer design