SecReT4
Protein ID: 158425489
T4SS name [ID]Trb [248]
Gene symboltrbF
Locus tagAZC_3865
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4416680..4417369 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA8IPE4
KEGG IDazc:AZC_3865
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.6e-61, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|158425489|ref|YP_001526781.1| trbF gene product [Azorhizobium caulinodans ORS 571]
MNLFKRPATHYGTSPEPVTPYQKAAQVWDERIGSARVQAKNWRLMAFGSLFLSVGFASVLVWQSTRGTVV
PWVVEVDRLGQTQAVGPATGEYRPTDPQIAWHLARFIEQVRSLPADPVIVRQNWLRAYEFTTDRGAAALN
DYARANDPFTRVGKQQIAVEVSSVIRASPDSFRVAWVERRYENGQLAATERWSAILTLVIQPPRDAERLR
TNPLGIYVNAISWSREMSQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|158421624|ref|NC_009937.1|:4416680-4417369 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGAACCTCTTCAAGCGACCTGCGACCCATTACGGAACGTCGCCCGAGCCGGTCACGCCCTATCAGAAGG
CAGCTCAGGTGTGGGACGAGCGCATCGGTTCGGCCCGTGTACAGGCGAAGAATTGGCGGCTGATGGCCTT
TGGTAGCCTGTTCCTCTCAGTCGGCTTTGCCTCCGTGCTTGTCTGGCAATCGACGAGGGGCACCGTCGTG
CCCTGGGTGGTCGAGGTCGATCGCCTCGGCCAGACGCAGGCCGTAGGGCCGGCCACCGGCGAGTATCGCC
CAACCGATCCGCAGATTGCTTGGCATCTTGCCCGCTTCATCGAGCAGGTGCGCAGCCTGCCGGCCGATCC
CGTGATTGTGCGGCAGAACTGGCTCAGGGCCTATGAGTTCACCACCGATCGGGGTGCTGCCGCTCTTAAC
GACTATGCACGCGCCAATGATCCGTTCACGCGGGTCGGCAAGCAGCAGATCGCCGTCGAGGTCTCCAGCG
TGATCCGGGCCTCGCCGGATTCCTTCCGCGTCGCCTGGGTCGAGCGGCGCTATGAGAACGGCCAGCTCGC
CGCCACCGAGCGCTGGAGCGCGATCCTGACGCTGGTGATACAGCCACCGCGCGATGCCGAGCGCCTGCGC
ACCAATCCGCTCGGCATCTATGTCAACGCCATCAGTTGGTCGCGGGAGATGAGCCAGTGA
 Primer design