SecReT4
Protein ID: 158425490
T4SS name [ID]Trb [248]
Gene symboltrbG
Locus tagAZC_3866
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4417372..4418349 [+]
Productconjugal transfer protein
Component typeTrbG
UniProt IDA8IK65
KEGG IDazc:AZC_3866
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.5e-61, Aligned region: 102..318
Protein Sequence: 325 a.a.     [Download]
>gi|158425490|ref|YP_001526782.1| trbG gene product [Azorhizobium caulinodans ORS 571]
MSFRKSTSQALRRSAFAVLLLSATMLGGCASAPKPPQISYDSDVPALPAVPAVVTDERPRPLHTPPAWTP
AKGGTDAKTPVARVENANAAARVEPRREGYYNAIQIYPWSEGALYQVYAAPGQITNIALEPGESLTGSGP
IAAGDTARWIIGDTESGEGVSRRVHVLVKPTRADISTNLVITTDRRSYMIELRAGEKPYMPAVAWAYPQV
PGALRPGVPPMPVIPSFAARNYRYALTGDTPPWRPMAVYDDGRKVYVEFPRGVIQGEMPPLFVIGADGEA
QIVNSRIHQNILIVDRLFGAAELRLGGGERPQKVRIERTDGRPAS
 
Nucleotide Sequence: 978 bp     [Download]
>gi|158421624|ref|NC_009937.1|:4417372-4418349 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGTCTTTCCGTAAATCCACATCTCAGGCTCTGCGCCGATCCGCCTTTGCGGTTCTTCTGCTTTCGGCGA
CGATGTTGGGCGGCTGCGCTTCGGCTCCGAAGCCGCCGCAGATCAGCTATGACAGTGACGTGCCGGCCCT
GCCTGCGGTGCCAGCCGTCGTCACCGATGAGCGGCCTCGTCCGCTCCACACGCCGCCCGCCTGGACGCCG
GCCAAGGGCGGCACGGACGCCAAAACGCCCGTTGCCCGCGTCGAGAACGCCAATGCCGCCGCGCGGGTCG
AGCCGCGCCGCGAGGGCTATTACAACGCCATCCAGATCTATCCCTGGAGCGAGGGCGCGCTCTATCAGGT
CTATGCAGCGCCCGGCCAGATCACCAACATCGCACTGGAGCCGGGCGAGAGCCTGACCGGCAGCGGGCCG
ATCGCCGCGGGCGACACCGCGCGCTGGATTATCGGCGACACGGAGAGCGGCGAAGGGGTTAGCCGGCGCG
TGCATGTGCTGGTAAAGCCGACGCGGGCTGACATCTCCACCAACCTCGTCATCACCACCGACCGCCGCAG
CTACATGATCGAGCTGCGGGCCGGCGAGAAGCCCTATATGCCGGCTGTCGCCTGGGCCTATCCGCAGGTT
CCGGGAGCGCTGCGCCCCGGTGTTCCGCCTATGCCGGTCATCCCGAGCTTCGCCGCCCGCAACTACCGCT
ATGCGCTCACCGGCGACACGCCGCCCTGGCGGCCGATGGCCGTCTATGACGACGGGCGCAAGGTCTATGT
CGAGTTCCCACGCGGGGTCATTCAGGGCGAGATGCCGCCGCTCTTCGTCATTGGGGCGGACGGGGAAGCG
CAGATCGTCAATAGCCGCATCCACCAGAACATCCTGATCGTCGACCGGCTGTTCGGTGCCGCCGAACTGC
GCCTCGGTGGCGGCGAGCGCCCGCAGAAGGTGCGGATCGAGCGCACGGACGGGAGGCCGGCATCATGA
 Primer design