SecReT4
Protein ID: 158425491
T4SS name [ID]Trb [248]
Gene symboltrbI
Locus tagAZC_3867
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T4SS(s) in this replicon]
Location [Strand]4418346..4419527 [+]
Producthypothetical protein
Component typeTrbI
UniProt IDA8IK67
KEGG IDazc:AZC_3867
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4e-58, Aligned region: 210..388
Protein Sequence: 393 a.a.     [Download]
>gi|158425491|ref|YP_001526783.1| trbI gene product [Azorhizobium caulinodans ORS 571]
MSSPDNHDIEADFGAPTTDHAAAMRLRTEPPRVTRLSRKVLAGAGLVVSLGIGGALIYALQGRDKGTGGE
ELYSTQNRSTADGLAGLPRDYTGPILGPPLPGDLGRPILEAQNRGQPVVPPTMTAPQVDPEQQRRLAEQE
AARTSRVFFQAAQARAPASSVASASGFSGPGSAGTGGTSSPQDRQLAFLNATVDRRVVASDRVMAPASPY
VLQAGAVIPAALITGIRSDLPGQITAQVTENVYDSPTGRIMIIPQGTRLLGQYDIGVGFGQRRILLVWSR
LIFPNGRSIVLERQPGTDAQGYAGLEDGVDMHWWDLAKAVGLSTLLSVSAELAMDDQDALIQALQSGAQD
TINNAGQEIIRRQLNVAPTLTIRPGFPVRVMVTRDLVLEPYRY
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|158421624|ref|NC_009937.1|:4418346-4419527 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGAGCAGCCCCGACAATCATGACATCGAGGCGGATTTCGGCGCTCCGACCACCGATCACGCCGCGGCCA
TGCGGCTGCGTACAGAGCCGCCGCGCGTCACGCGTCTCTCGCGCAAGGTCCTCGCTGGCGCCGGGCTGGT
TGTCAGCCTCGGCATAGGCGGCGCCCTGATCTATGCGCTGCAGGGTCGCGACAAGGGCACCGGCGGCGAG
GAACTCTACTCCACCCAGAACCGCTCCACGGCCGATGGCCTTGCCGGCCTGCCACGGGACTATACCGGGC
CGATCCTGGGTCCGCCGCTGCCCGGCGATCTCGGCCGGCCGATCCTTGAGGCGCAGAACCGCGGCCAGCC
CGTCGTGCCGCCGACAATGACAGCGCCACAGGTGGATCCTGAGCAGCAGCGGCGTCTTGCGGAACAGGAA
GCCGCGCGGACCAGTCGCGTATTCTTCCAGGCGGCGCAGGCCCGCGCGCCGGCGTCGTCAGTGGCGAGTG
CTTCCGGCTTCAGCGGCCCTGGCTCGGCAGGAACGGGCGGCACGTCCTCACCCCAGGATCGCCAGCTTGC
CTTCCTCAATGCCACTGTGGATCGGCGCGTTGTCGCGTCCGATCGCGTCATGGCGCCGGCATCGCCTTAT
GTGCTGCAGGCGGGCGCCGTCATCCCGGCCGCGCTGATCACCGGCATCCGCTCCGATTTGCCCGGCCAGA
TCACCGCCCAGGTCACCGAGAACGTCTATGACAGCCCGACCGGACGCATCATGATCATTCCGCAGGGCAC
GCGGCTGCTCGGCCAGTACGACATTGGTGTCGGCTTCGGTCAGCGCCGGATCCTGCTGGTCTGGAGCCGG
CTGATCTTCCCCAATGGCCGCTCCATCGTGCTGGAGCGCCAGCCCGGCACCGATGCGCAGGGCTATGCCG
GCCTCGAGGACGGCGTCGACATGCACTGGTGGGACCTCGCCAAGGCGGTTGGCCTCTCGACGCTGCTCTC
CGTCAGCGCCGAGCTCGCCATGGATGATCAGGATGCATTGATTCAGGCGCTCCAAAGCGGGGCGCAGGAC
ACCATCAATAATGCCGGCCAGGAGATCATCCGCCGGCAGTTAAACGTCGCACCCACCCTGACCATCCGGC
CCGGCTTCCCGGTGCGGGTCATGGTCACCCGTGACCTCGTCCTCGAGCCCTACAGGTACTGA
 Primer design