SecReT4
Protein ID: 15892308
T4SS name [ID]VirB [495]
Gene symbolvirB8
Locus tagRC0385
StrainRickettsia conorii str. Malish 7
Repliconchromosome [GenBank: NC_003103] [Browse all T4SS(s) in this replicon]
Location [Strand]386055..386753 [-]
ProductvirB8 protein
Component typeVirB8
UniProt IDQ92IN5
KEGG IDrco:RC0385
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-17, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|15892308|ref|NP_360022.1| virB8 protein [Rickettsia conorii str. Malish 7]
MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLLLICTIFTLLLTLICININILLPINKKVKYL
IKDDAEKQAAVTNTKHSTLVKPYISIANIMLQNYVNQREEYNYDILKEQFTFIKNASTSIVYMQFANFMN
IDNPLSPVIRYQKLYRRSINILSINNINNNEAVVTFESLAKNSTDAILENMVWEARIGFIMDSISTNTSP
DMPFNFTVTSYKLKLLRNKNQK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|15891923|ref|NC_003103.1|:c386753-386055 Rickettsia conorii str. Malish 7, complete genome
ATGGACCCATTAACCAACGCAATACAAGAATATATAAAATCCGGCGAATATTTTATTGATGCAAGAAAAT
GGTATAATTTTAAGTATATCTTACCGTTAAGTCATAGAAGTCTTCTGCTTTTAATATGCACGATTTTTAC
CTTATTATTAACCTTAATTTGTATAAATATCAACATATTGCTACCTATAAACAAAAAAGTAAAGTATTTA
ATAAAAGATGATGCCGAAAAACAAGCTGCCGTTACTAATACTAAACATTCAACATTAGTAAAGCCTTATA
TCTCTATTGCAAATATTATGCTTCAGAATTATGTAAACCAACGAGAAGAATACAATTACGATATATTAAA
AGAACAATTTACCTTTATCAAAAATGCTTCTACGAGTATTGTTTATATGCAATTTGCTAATTTTATGAAT
ATTGATAACCCATTATCACCGGTCATAAGATATCAAAAACTATATAGACGCTCAATTAATATATTATCAA
TTAACAATATAAACAATAACGAGGCAGTTGTTACTTTTGAATCATTGGCAAAAAATAGTACGGATGCAAT
TTTAGAAAATATGGTATGGGAAGCAAGAATCGGATTTATAATGGATTCTATCAGTACAAATACATCACCT
GATATGCCGTTCAATTTTACCGTTACTAGTTACAAGCTAAAATTATTAAGGAATAAAAATCAGAAATAA
 Primer design