SecReT4
Protein ID: 15892310
T4SS name [ID]VirB [495]
Gene symbol-
Locus tagRC0387
StrainRickettsia conorii str. Malish 7
Repliconchromosome [GenBank: NC_003103] [Browse all T4SS(s) in this replicon]
Location [Strand]387449..388180 [+]
Producthypothetical protein
Component typeVirB8
UniProt IDQ92IN3
KEGG IDrco:RC0387
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-44, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|15892310|ref|NP_360024.1| hypothetical protein RC0387 [Rickettsia conorii str. Malish 7]
MNNIFGFFKSSNNSQSGAGDTQTQESIKSANPLKITQNWYEERSDKLLVQRNLLIILIILLTIFMVIATL
VIAFVVKSKQFEPFVIQLNSNTGRASVVEPISSPVLTADESLTRYFIKKYITARETYNPVDFATIARTTI
RLFSTSSVYYNYLGYIRNKDFDPTLKYKEENTTFLVVKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVV
SYAYVPMQLTDSELDVNPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|15891923|ref|NC_003103.1|:387449-388180 Rickettsia conorii str. Malish 7, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAATAACTCGCAAAGCGGTGCAGGAGATACACAAACGC
AAGAAAGTATTAAATCGGCTAATCCTTTAAAAATTACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
ACTTGTTCAACGTAACTTACTTATCATATTAATAATACTACTAACCATTTTTATGGTTATAGCAACTTTA
GTAATAGCCTTTGTAGTGAAATCTAAACAGTTTGAGCCTTTTGTTATTCAGCTTAATAGTAATACCGGAC
GTGCCTCAGTGGTAGAACCTATTTCATCACCAGTGTTAACGGCGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCACGGGAAACATATAATCCGGTTGATTTTGCGACGATAGCTCGTACGACAATA
AGATTATTTTCAACAAGCAGTGTTTATTACAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGAAGAGAATACTACATTTTTAGTAGTAAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCCGTAAATGAAACATCAGGCAACCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGATGTAAATCCGGTAGGGTTTCAAGTGA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design