SecReT4
Protein ID: 15892313
T4SS name [ID]VirB [495]
Gene symbolvirB11
Locus tagRC0390
StrainRickettsia conorii str. Malish 7
Repliconchromosome [GenBank: NC_003103] [Browse all T4SS(s) in this replicon]
Location [Strand]390270..391274 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ92IN0
KEGG IDrco:RC0390
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-93, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|15892313|ref|NP_360027.1| type IV secretion system ATPase VirB11 [Rickettsia conorii str. Malish 7]
MNEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPELDSEHLLALGSLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPSGMNLTLDEYAKMGAFDDTATESLVDEDAVIL
NNFLAEKKIKEFIRHAVVSKKNIIISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSCHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILAVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|15891923|ref|NC_003103.1|:390270-391274 Rickettsia conorii str. Malish 7, complete genome
ATGAATGAAGAATTTGCAGCCTTAGAGACGTTTTTACTTCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAACGAAATTATGGTTAATAAGCCCGGAGAAGTATGGGTTGAAAAAAAAGGCGATATATATTCTAAGCA
AATACCGGAACTGGATAGCGAACATCTACTTGCATTAGGGAGTTTAGTCGCTCAATCTACCGAACAGATG
ATTTCAGAAGAAAAACCGCTTCTTTCGGCAACGTTGCCGAATGGCTACCGTATTCAAATAGTATTTCCTC
CTGCTTGTGAGATAGGACAAATCATTTATGCTATAAGAAAGCCTAGCGGTATGAATCTAACTTTAGATGA
ATATGCTAAAATGGGGGCATTTGATGATACTGCAACAGAGAGTTTAGTAGATGAAGATGCAGTAATTTTA
AATAATTTCTTAGCTGAAAAAAAGATTAAAGAATTTATTAGACATGCAGTTGTTTCAAAGAAAAATATCA
TAATTAGCGGCGGTACTTCAACCGGTAAAACTACTTTTACTAATGCGGCACTCACTGAAATACCTGCAAT
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAGGTTGTGCTATCATGCCATCCTAACAGAGTGCATTTA
CTGGCTTCCAAAGGAGGACAGGGGCGTGCAAATGTTACTACTCAAGATTTAATAGAGGCCTGTTTGCGTT
TAAGACCAGATAGGATTATAGTAGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGTCATCCCGGTTCAATATCAACACTGCATGCTGATAGTCCCGCTATGGCTATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCGCCTGAAGAAGTAAAGAAGTATATTTTAGCCGTTGTAG
ATATCGTTGTGCAGTTAAAACGCGGTAGCGGCGGGAAAAGATATGTTTCGGAAGTATATTATAAGAAGAA
CAAGAACGCTGAGGGGATGGTTTAA
 Primer design