SecReT4
Protein ID: 159046187
T4SS name [ID]VirB [470]
Gene symbol-
Locus tagDshi_3645
StrainDinoroseobacter shibae DFL 12
Repliconplasmid pDSHI01 [GenBank: NC_009955] [Browse all T4SS(s) in this replicon]
Location [Strand]44855..45511 [+]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA8LT11
KEGG IDdsh:Dshi_3645
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.5e-42, Aligned region: 7..212
Protein Sequence: 218 a.a.     [Download]
>gi|159046187|ref|YP_001541859.1| VirB8 family protein [Dinoroseobacter shibae DFL 12]
MVASEQEIIEEELVYGALRRERLWQRLGLMGLVFGIIGCLSAAAVSILDVDPPPVVVPYDPATGFALPEA
SVGATSVTANQAIIEAEVFRYVTDREVYNQLDNDLRIRSVLRRSDGAAESGLRQIWNSANENYPPTVYGP
NARLDVEILSINRIGTNRATVRLRKRLTSINGTQTGLFTATLLFEFRPETRRSIDEVWTNPFGFTVLEYS
IRSDRLEN
 
Nucleotide Sequence: 657 bp     [Download]
>gi|159046135|ref|NC_009955.1|:44855-45511 Dinoroseobacter shibae DFL 12 plasmid pDSHI01, complete sequence
ATGGTGGCGAGTGAACAAGAAATCATCGAGGAAGAACTGGTCTACGGTGCCCTGCGCCGCGAACGGCTCT
GGCAACGCCTTGGCCTGATGGGCCTTGTCTTCGGTATCATCGGCTGTCTGAGTGCCGCGGCTGTCTCGAT
CCTCGATGTCGATCCGCCACCTGTGGTCGTCCCCTATGATCCCGCCACTGGTTTTGCCCTGCCCGAGGCG
TCCGTTGGGGCCACATCCGTCACCGCCAACCAGGCGATCATCGAGGCAGAGGTGTTCCGCTATGTGACCG
ACCGGGAGGTCTATAACCAGCTCGACAACGATCTGCGCATCCGCAGCGTCCTGCGCCGCTCGGACGGAGC
TGCCGAGAGCGGGCTGCGCCAGATCTGGAACAGCGCCAACGAGAATTACCCGCCGACGGTTTATGGCCCC
AATGCCCGGCTCGACGTGGAAATCCTCAGCATCAACCGGATCGGAACCAACCGCGCGACGGTCCGCCTGC
GCAAGCGCCTGACGTCCATTAACGGCACCCAGACCGGGCTCTTCACTGCGACGCTTCTCTTCGAGTTCCG
CCCGGAGACCCGCCGGTCCATCGACGAGGTCTGGACCAACCCGTTTGGGTTCACCGTGCTCGAATATTCC
ATCCGCTCCGACAGATTGGAGAATTAG
 Primer design