SecReT4
Protein ID: 159046190
T4SS name [ID]VirB [470]
Gene symbol-
Locus tagDshi_3648
StrainDinoroseobacter shibae DFL 12
Repliconplasmid pDSHI01 [GenBank: NC_009955] [Browse all T4SS(s) in this replicon]
Location [Strand]47589..48575 [+]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDA8LT14
KEGG IDdsh:Dshi_3648
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.7e-56, Aligned region: 16..306
Protein Sequence: 328 a.a.     [Download]
>gi|159046190|ref|YP_001541862.1| type II secretion system protein E [Dinoroseobacter shibae DFL 12]
MSLSYLETSLDRIDAAARDDVIEICINPDGTCWGEFQGDHFMRALDQRLTGVQVRDLGNQIASSANTTMS
KDRPIVSVSITYKGRPIRAQVITPPAVLSAMSISLRFFSSLPLEGIALDFLYGKERKLEDLRVEKKRALR
AVVAAGLIDDALAFCVENKLNMIVSGGTSTGKTVAARKILSHVPAEERIVTIEEAAELLPTQPNAVTLIA
NRDTEFQSADVLLTATLRMRPDRIILGEVRGKEAMTFLEAINTGHGGSMTTLHAETPQLAVQRLAIAALK
TEIPMTYADMIQYIENSIDVIIQAGRHDGKRGITEFYLPGATEIGISP
 
Nucleotide Sequence: 987 bp     [Download]
>gi|159046135|ref|NC_009955.1|:47589-48575 Dinoroseobacter shibae DFL 12 plasmid pDSHI01, complete sequence
ATGTCGCTGAGCTATCTCGAAACCTCGCTCGACCGGATCGACGCCGCCGCCCGCGACGATGTCATCGAGA
TCTGCATCAACCCCGACGGGACCTGCTGGGGAGAATTCCAGGGTGATCACTTCATGCGCGCGCTGGACCA
GAGGCTGACGGGCGTTCAGGTCCGAGACCTCGGCAACCAGATCGCCTCCTCGGCAAATACCACCATGAGC
AAGGACCGTCCCATCGTCTCGGTTTCGATCACCTATAAGGGTCGCCCGATCCGGGCACAGGTCATCACCC
CGCCCGCCGTGCTCTCGGCCATGTCGATCAGCTTGCGGTTCTTCTCGAGCCTGCCGCTCGAGGGCATTGC
GCTCGACTTTCTCTATGGCAAAGAGCGCAAGCTCGAAGACCTGCGCGTCGAAAAAAAGCGCGCCTTGCGC
GCCGTGGTGGCTGCCGGATTGATCGATGATGCGCTTGCCTTCTGCGTCGAGAACAAACTCAACATGATTG
TCTCGGGCGGCACCTCCACCGGCAAAACCGTAGCCGCGCGCAAGATCCTCTCTCACGTACCGGCCGAAGA
ACGCATTGTCACCATAGAGGAAGCGGCCGAGCTTCTGCCGACCCAGCCAAATGCCGTGACCCTCATCGCC
AATCGCGACACAGAATTCCAGTCCGCCGATGTGCTTCTCACCGCCACGCTGCGCATGCGCCCCGACCGGA
TCATCCTGGGCGAGGTGCGCGGCAAGGAGGCCATGACCTTCCTCGAAGCCATCAACACCGGCCATGGCGG
GTCCATGACCACACTGCATGCCGAAACCCCGCAACTCGCCGTGCAGCGGCTCGCGATCGCGGCACTCAAG
ACCGAAATCCCGATGACCTATGCCGACATGATCCAGTACATCGAGAATTCCATCGATGTGATCATCCAGG
CCGGTCGCCATGACGGAAAACGCGGCATCACCGAATTCTACCTCCCCGGCGCAACTGAGATTGGAATTTC
CCCATGA
 Primer design