SecReT4
Protein ID: 159046197
T4SS name [ID]VirB [470]
Gene symbol-
Locus tagDshi_3655
StrainDinoroseobacter shibae DFL 12
Repliconplasmid pDSHI01 [GenBank: NC_009955] [Browse all T4SS(s) in this replicon]
Location [Strand]55361..57364 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDA8LT21
KEGG IDdsh:Dshi_3655
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3e-87, Aligned region: 127..541
TraG-D_C [PF12696], Evalue: 4e-28, Aligned region: 386..507
TrwB_AAD_bind [PF10412], Evalue: 1.1e-17, Aligned region: 135..521
AAA_10 [PF12846], Evalue: 3.2e-08, Aligned region: 134..467
Protein Sequence: 667 a.a.     [Download]
>gi|159046197|ref|YP_001541869.1| TRAG family protein [Dinoroseobacter shibae DFL 12]
MGKARIATGVFLVTLVTGAMGYTIASAVLTYQDLGFGAEIDFAYIAQNYMAILDRRPEDAQLIHLIIGSF
AAAGLMLSLALSGSALTRFGQTHWQTAREMKANGFFGAPGTGFILGKLGPPGSRANYICSKVFPHALIVA
PTGRGKTTGFVIPNLLTWQGSAVTLDVKGECFEATARHRAAQGDKVYRFAPTDWEGKRTHRYNPLLRIYQ
LKDPARQQMELQLLATLFLQSDNDRVQGLLKGGIDLFVAAGLLAFQRKRPTLGEIYRIAASGGNKQKEYF
ARGHEVDNRAAKLIFTRLASTNNDTLTSYVSLLMTSGLDQWQNPAIDEATAVSDFDFRTIRKKPFSVYLV
VQPLMVKPLAPLIRLFFSDLLSAMQEKDPGPDEPWPVMIMLDEFNRLGKMPIVVESIETLRTYRGHLAVV
TQTIPALDEIYGENTRRALQGNAGVKLYLTPSDEKTVEELSKAVGKTTKTVVTRSQSIGKNPFEGRSQST
RTEESSLLPEDEARRLPLDEIVMVIDAQMPVRAKRIQYFDDRLFKAIHAAQTGELPFPEPGGGGPQGTLP
LSMRAMPMTPPANGPGGSDAVVETTRQEAGSQPSGQTDVALKKTAPVVLAVIAEEQRQMEMDFGGQVADA
ETVGVDDEAQLRSAVDGLDDMEAMLQEGDGGEKLVAR
 
Nucleotide Sequence: 2004 bp     [Download]
>gi|159046135|ref|NC_009955.1|:c57364-55361 Dinoroseobacter shibae DFL 12 plasmid pDSHI01, complete sequence
ATGGGAAAAGCGCGGATCGCCACAGGGGTCTTTCTGGTAACGCTGGTGACCGGGGCTATGGGCTATACCA
TCGCCTCGGCGGTGCTGACCTACCAGGATCTCGGGTTCGGGGCCGAGATCGACTTTGCCTATATCGCGCA
GAACTACATGGCGATCCTCGATCGCCGCCCGGAGGATGCGCAACTTATTCACCTGATCATCGGCAGCTTC
GCCGCCGCCGGGCTGATGCTGAGCCTCGCCCTCTCAGGGTCCGCCCTGACACGCTTTGGCCAGACCCATT
GGCAGACCGCGCGCGAGATGAAGGCCAATGGGTTCTTCGGGGCGCCCGGCACCGGGTTCATCCTCGGCAA
GCTGGGGCCGCCGGGCTCCCGCGCCAATTACATTTGCTCGAAGGTTTTTCCGCATGCGCTGATCGTGGCC
CCCACGGGCCGAGGCAAGACCACGGGCTTCGTCATCCCGAACCTGCTGACCTGGCAAGGCTCCGCCGTGA
CGCTCGATGTGAAGGGCGAGTGCTTTGAGGCCACGGCCCGGCACCGCGCCGCCCAAGGCGACAAGGTCTA
TCGCTTTGCCCCCACCGATTGGGAGGGCAAGCGCACGCATCGTTACAACCCGCTCTTGCGCATCTATCAA
CTGAAAGACCCCGCCCGCCAGCAGATGGAATTGCAGCTCCTGGCGACGCTCTTCCTGCAGAGTGACAACG
ACCGGGTGCAGGGCCTCCTCAAAGGCGGAATCGATCTCTTCGTGGCGGCAGGCCTGCTGGCCTTCCAGCG
CAAGCGCCCCACCTTGGGCGAGATCTACCGCATCGCCGCCTCGGGCGGAAACAAGCAGAAGGAGTATTTC
GCGCGGGGCCACGAGGTCGACAACAGGGCCGCCAAGTTGATCTTCACGCGGCTGGCCTCAACCAACAACG
ATACGCTGACCTCCTATGTCTCGCTCCTGATGACATCGGGGCTCGATCAATGGCAGAACCCGGCCATCGA
TGAGGCGACGGCGGTGTCGGACTTTGATTTCCGGACGATCCGCAAGAAGCCCTTCTCGGTCTATCTGGTG
GTCCAGCCGCTGATGGTGAAGCCGCTGGCGCCGCTGATCCGGCTCTTCTTCTCCGATCTTCTCTCCGCCA
TGCAGGAAAAGGATCCCGGGCCGGATGAACCCTGGCCCGTGATGATCATGCTCGACGAGTTCAATCGCCT
TGGCAAAATGCCCATTGTGGTAGAAAGCATCGAGACCCTGCGCACCTATCGTGGTCACCTCGCCGTGGTC
ACCCAAACCATCCCCGCCCTCGATGAAATCTACGGCGAGAACACCCGTCGAGCCCTGCAGGGCAACGCGG
GCGTGAAGCTCTATCTGACGCCCTCCGATGAAAAGACCGTCGAGGAGCTGAGCAAAGCGGTCGGCAAGAC
CACGAAGACCGTCGTCACGCGCTCGCAGTCCATCGGCAAGAACCCCTTTGAAGGGCGCAGCCAATCCACG
CGGACTGAAGAGAGCTCGTTGTTGCCCGAAGATGAGGCGCGCCGCCTGCCGCTCGATGAAATCGTCATGG
TCATCGATGCCCAGATGCCGGTCCGTGCAAAGCGGATCCAGTACTTCGATGATCGGCTGTTCAAGGCGAT
CCACGCGGCGCAGACAGGGGAGTTGCCGTTTCCGGAGCCGGGGGGAGGGGGGCCGCAAGGCACGCTGCCG
CTGAGCATGCGCGCCATGCCGATGACACCGCCCGCGAACGGACCAGGTGGGTCTGACGCCGTTGTGGAGA
CCACACGCCAAGAAGCGGGCAGTCAACCGTCAGGGCAAACCGACGTCGCCCTAAAAAAGACCGCGCCCGT
CGTTCTAGCCGTTATCGCCGAGGAACAGCGACAGATGGAAATGGATTTTGGGGGCCAGGTTGCGGATGCC
GAGACAGTGGGCGTGGATGATGAAGCTCAGTTGCGCTCTGCTGTCGATGGCTTGGACGACATGGAGGCGA
TGCTGCAGGAGGGCGATGGCGGTGAAAAGCTGGTTGCTCGATAG
 Primer design