SecReT4
Protein ID: 159046519
T4SS name [ID]VirB [469]
Gene symbol-
Locus tagDshi_3980
StrainDinoroseobacter shibae DFL 12
Repliconplasmid pDSHI03 [GenBank: NC_009957] [Browse all T4SS(s) in this replicon]
Location [Strand]39197..39850 [+]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA8LU00
KEGG IDdsh:Dshi_3980
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1e-42, Aligned region: 6..211
Protein Sequence: 217 a.a.     [Download]
>gi|159046519|ref|YP_001542189.1| VirB8 family protein [Dinoroseobacter shibae DFL 12]
MASEQEIIEEELVYGALRRERLWQRLGLAGLVFGIIGCLSAAAVSILDVDPPPVVVPYDPATGFALPEAS
VGASSVTANQAIIEAEVFRYVTDREIYNQLDNDLRIRSVLRRSDGAAESRLRQIWNSANENYPPTVYGPN
ARLDVEILSINRIGSNRATVRLRKRLTSINGTQTGLFTATLLFEFRPETRRSIDEVWTNPFGFTVLEYSI
RSDRLEN
 
Nucleotide Sequence: 654 bp     [Download]
>gi|159046469|ref|NC_009957.1|:39197-39850 Dinoroseobacter shibae DFL 12 plasmid pDSHI03, complete sequence
GTGGCGAGTGAACAAGAGATCATCGAGGAAGAACTGGTCTACGGTGCCTTGCGCCGCGAACGGCTCTGGC
AACGCCTTGGTCTGGCAGGTCTTGTCTTCGGCATCATCGGCTGTCTGAGTGCCGCGGCTGTCTCGATCCT
CGATGTCGATCCGCCCCCCGTCGTTGTCCCCTATGATCCCGCTACCGGCTTTGCACTCCCCGAGGCCTCG
GTGGGCGCTTCCTCGGTGACCGCCAACCAGGCGATCATCGAGGCGGAGGTCTTCCGCTATGTGACCGACC
GGGAGATCTACAATCAGCTCGATAACGATCTGCGCATCCGCAGCGTCCTGCGCCGCTCGGACGGGGCCGC
CGAGAGCAGGCTGCGCCAGATATGGAACAGCGCAAATGAAAACTATCCACCGACCGTCTATGGCCCCAAT
GCCCGGCTCGACGTGGAAATTCTCAGCATCAACCGGATCGGATCCAACCGCGCCACCGTGCGCTTGCGCA
AGCGGCTGACCTCCATCAACGGCACCCAGACCGGGCTCTTCACCGCCACGCTTCTCTTCGAGTTCCGTCC
CGAAACCCGTCGCTCCATCGACGAGGTCTGGACCAATCCGTTTGGGTTTACCGTGCTCGAATATTCCATC
CGCTCCGACAGATTGGAGAACTGA
 Primer design