SecReT4
Protein ID: 159046522
T4SS name [ID]VirB [469]
Gene symbol-
Locus tagDshi_3983
StrainDinoroseobacter shibae DFL 12
Repliconplasmid pDSHI03 [GenBank: NC_009957] [Browse all T4SS(s) in this replicon]
Location [Strand]41929..42915 [+]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDA8LU03
KEGG IDdsh:Dshi_3983
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.5e-56, Aligned region: 14..306
Protein Sequence: 328 a.a.     [Download]
>gi|159046522|ref|YP_001542192.1| type II secretion system protein E [Dinoroseobacter shibae DFL 12]
MSLSYLETSLDRIEAAARDDVIEICINPDGTCWGEFQGDHFMRALDQRLTGVQVRDLGNQIASSANTTMS
KDRPIVSVSITYKGRPIRAQVITPPAVLSAMSISLRFFSSLPLEGIALDFLFGKERKLEDLRVEKKRALR
AVVAAGLIDDALAFCVENKLNMIVSGGTSTGKTVAARKILSHVPAEERIVTIEEAAELLPTQPNAVTLIA
NRDAEFQTADVLLTATLRMRPDRIILGEVRGKEAMTFLEAINTGHGGSMTTLHAETPQLAVQRLAIAALK
TEIPMTYADMIQYIENSIDVIIQAGRHDGKRGITEFYLPGATEIGISP
 
Nucleotide Sequence: 987 bp     [Download]
>gi|159046469|ref|NC_009957.1|:41929-42915 Dinoroseobacter shibae DFL 12 plasmid pDSHI03, complete sequence
ATGTCGCTGAGCTATCTCGAAACCTCCCTCGACCGGATCGAAGCCGCCGCCCGCGACGATGTCATCGAGA
TCTGCATCAACCCCGACGGGACCTGCTGGGGCGAATTCCAGGGCGATCACTTCATGCGCGCGCTGGATCA
AAGGCTGACGGGCGTTCAGGTCAGGGACCTCGGCAACCAGATCGCCTCCTCGGCCAATACCACGATGAGC
AAGGACCGCCCCATCGTCTCGGTATCGATCACCTACAAGGGTCGCCCGATCCGGGCACAGGTCATCACCC
CGCCCGCCGTGCTCTCGGCCATGTCGATCAGCTTGCGGTTCTTCTCGAGCCTGCCGCTCGAGGGCATTGC
GCTCGACTTTCTCTTTGGCAAAGAGCGCAAGCTCGAAGACCTGCGCGTCGAAAAAAAGCGCGCCTTGCGC
GCCGTGGTGGCCGCGGGTTTGATCGATGATGCGCTGGCCTTCTGCGTCGAGAACAAACTCAACATGATCG
TCTCGGGTGGCACCTCCACCGGCAAGACCGTCGCCGCGCGCAAGATCCTCTCTCACGTACCGGCCGAGGA
ACGCATCGTCACCATCGAAGAAGCGGCCGAGCTGCTGCCGACCCAGCCAAATGCAGTGACCCTCATCGCC
AATCGCGACGCGGAATTCCAGACCGCCGATGTGCTTCTCACCGCCACGCTGCGCATGCGCCCCGACCGGA
TCATCCTGGGCGAAGTGCGCGGCAAGGAGGCCATGACCTTTCTGGAAGCCATCAACACCGGCCACGGCGG
GTCCATGACCACGCTGCATGCCGAAACACCGCAACTGGCCGTGCAGCGGCTTGCGATCGCAGCACTGAAA
ACCGAGATCCCGATGACCTATGCCGACATGATCCAGTACATCGAAAATTCCATCGATGTGATCATCCAGG
CCGGTCGCCATGACGGAAAACGCGGCATCACGGAATTCTACCTCCCCGGAGCAACTGAGATTGGAATTTC
CCCATGA
 Primer design