SecReT4
Protein ID: 159046527
T4SS name [ID]VirB [469]
Gene symbol-
Locus tagDshi_3988
StrainDinoroseobacter shibae DFL 12
Repliconplasmid pDSHI03 [GenBank: NC_009957] [Browse all T4SS(s) in this replicon]
Location [Strand]48594..50606 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDA8LU08
KEGG IDdsh:Dshi_3988
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5e-87, Aligned region: 131..545
TraG-D_C [PF12696], Evalue: 4.2e-28, Aligned region: 390..511
TrwB_AAD_bind [PF10412], Evalue: 6.7e-18, Aligned region: 139..525
AAA_10 [PF12846], Evalue: 1.7e-08, Aligned region: 138..471
Protein Sequence: 670 a.a.     [Download]
>gi|159046527|ref|YP_001542197.1| TRAG family protein [Dinoroseobacter shibae DFL 12]
MSAAMGKVRIATGVLLVTLVTGAMGYTIASAVLTYQDLGFGAEIDFAYIAQNYLAILDRRPEDAQLIHLI
IGSFAAAGMMLSLALSGSALTRFGQTHWQTSREMKANGFFGAPGTGFILGKLGAPGSRANYICSTVFPHA
LIVAPTGRGKTTGFVIPNLLTWQGSAVTLDVKGECFEATARHRAAQGDKVYRFAPTDWESKRTHRYNPLL
RIYQLKDPARQQMELQLLATLFLQSDNDRVQGLLKGGIDLFVAAGLLAFQRKRPTLGEIYRIAASGGNKQ
KEYFARGHEVENRAAKLIFTRLASTNNDTLTSYVSLLMTSGLDQWQNPAIDEATAVSDFDFRTIRKKPFS
VYLVVQPLMVKPLAPLIRLFFSDLLSAMQEKDPGPDEPWPVMIMLDEFNRLGKMPIVVESIETLRTYRGH
LAVVTQTIPALDEIYGENTRRALQGNAGVKLYLTPSDEKTVEELSKAVGKTTKTVVTRSQSIGKNPFEGR
SQSTRTEESSLLPEDEARRLPLDEIVMVIDAQMPVRAKRIQYFDDRLFKAIHAAQTGELPFPEPGGGGPQ
GNLSLSMRAMPMTPPPDGPRGSEADVERAREVVDGQPSGQSDVVPKKTTPVVQAVIAEEQRQMEMDFGGQ
LADVETVGVDDDAQMRSAVDGLDEMEAMLQEDGGERLVAR
 
Nucleotide Sequence: 2013 bp     [Download]
>gi|159046469|ref|NC_009957.1|:c50606-48594 Dinoroseobacter shibae DFL 12 plasmid pDSHI03, complete sequence
TTGAGCGCCGCCATGGGAAAAGTCCGGATCGCCACGGGCGTCCTGCTCGTGACGCTGGTGACAGGGGCCA
TGGGCTATACCATCGCCTCGGCGGTGCTGACCTACCAGGACCTTGGCTTCGGGGCCGAGATCGACTTTGC
CTATATCGCGCAGAACTATCTGGCGATCCTCGATCGCCGCCCGGAGGACGCCCAACTCATCCACCTGATC
ATCGGTAGCTTCGCCGCCGCCGGTATGATGCTGAGCCTCGCCCTGTCGGGGTCCGCGCTCACACGCTTTG
GCCAGACCCATTGGCAGACCTCCCGCGAGATGAAGGCCAATGGGTTCTTCGGCGCGCCCGGGACGGGATT
CATCCTCGGTAAACTTGGGGCGCCGGGCTCCCGCGCCAACTACATCTGCTCGACGGTCTTTCCCCATGCG
CTGATCGTGGCCCCCACGGGTCGCGGCAAGACCACGGGTTTTGTCATTCCGAACCTGCTCACCTGGCAAG
GCTCTGCCGTGACGCTCGATGTGAAGGGCGAGTGTTTCGAGGCCACGGCGCGGCACCGCGCAGCCCAGGG
CGACAAGGTCTATCGCTTTGCTCCCACGGATTGGGAGAGCAAGCGCACCCATCGCTACAACCCGCTCCTG
CGCATCTATCAACTGAAAGATCCTGCGCGCCAGCAGATGGAACTGCAGCTCTTGGCGACGCTGTTCCTGC
AGAGTGACAACGACCGGGTGCAGGGCCTCCTTAAGGGCGGGATCGATCTCTTCGTGGCGGCAGGGCTTTT
GGCCTTCCAGCGCAAGCGCCCGACCTTGGGCGAGATTTACCGCATCGCTGCCTCGGGCGGGAACAAGCAG
AAGGAGTATTTTGCGCGCGGCCACGAGGTGGAGAACAGGGCCGCCAAGCTGATCTTCACGCGTCTGGCCT
CGACCAACAACGACACGCTGACCTCATACGTTTCGCTCCTGATGACCTCGGGGCTCGATCAATGGCAGAA
CCCTGCGATCGATGAGGCGACGGCGGTGTCGGACTTTGATTTCCGGACGATCCGCAAGAAGCCCTTTTCG
GTCTACCTCGTGGTCCAGCCGCTGATGGTGAAGCCGCTTGCGCCGCTGATCCGGCTGTTTTTCTCCGATC
TTCTCTCGGCCATGCAGGAAAAGGACCCCGGGCCGGATGAGCCTTGGCCCGTGATGATCATGCTCGATGA
GTTCAATCGCCTTGGCAAAATGCCGATCGTAGTCGAGAGCATCGAAACCCTGCGGACCTATCGTGGCCAT
CTGGCCGTAGTGACACAAACCATCCCCGCCCTCGATGAAATCTACGGCGAGAACACCCGCCGTGCGCTGC
AGGGCAATGCCGGCGTGAAACTGTACCTGACGCCCTCGGATGAGAAAACTGTCGAGGAACTGAGTAAGGC
GGTTGGCAAGACCACGAAGACCGTGGTCACGCGCTCCCAATCCATCGGCAAGAACCCCTTCGAAGGTCGC
AGCCAGTCCACAAGGACCGAAGAAAGCTCTCTGCTCCCTGAAGATGAAGCGCGCCGCCTTCCGCTCGATG
AGATCGTCATGGTCATCGATGCCCAAATGCCGGTCCGTGCGAAGCGGATCCAGTATTTTGACGATCGGCT
GTTCAAGGCGATCCACGCGGCGCAGACCGGCGAGTTGCCGTTTCCGGAGCCGGGGGGAGGGGGGCCGCAA
GGCAATCTGTCGTTGAGTATGCGCGCCATGCCGATGACGCCGCCACCGGACGGCCCGCGTGGATCTGAAG
CAGATGTGGAGAGGGCACGCGAGGTCGTTGACGGTCAACCGTCAGGGCAATCTGATGTAGTTCCAAAGAA
GACCACGCCTGTCGTTCAAGCCGTTATCGCCGAGGAACAGCGCCAGATGGAGATGGATTTTGGGGGACAG
CTTGCGGATGTCGAGACAGTGGGGGTGGATGATGATGCGCAGATGCGCTCCGCCGTTGATGGGTTGGACG
AAATGGAAGCGATGCTGCAAGAGGACGGTGGTGAAAGGCTGGTTGCTCGATAG
 Primer design