SecReT4
Protein ID: 159161956
T4SS name [ID]Trb [245]
Gene symboltrbC
Locus tagAtu6040
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid Ti [GenBank: NC_003065] [Browse all T4SS(s) in this replicon]
Location [Strand]49875..50276 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ7D2P2, Q9R489
KEGG IDatu:Atu6040
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7e-20, Aligned region: 5..100
Protein Sequence: 133 a.a.     [Download]
>gi|159161956|ref|NP_396557.2| conjugal transfer protein [Agrobacterium tumefaciens str. C58]
MSHKIRIAIALAAFAAGSFIGLADPAFASSGGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGGMLIFG
GELNDFARRLCYVALVGGVLLGATQIIALFGATGASIGEMEARTGPGIIEPVMLRAQGEGAHG
 
Nucleotide Sequence: 402 bp     [Download]
>gi|159161952|ref|NC_003065.3|:c50276-49875 Agrobacterium tumefaciens str. C58 plasmid Ti, complete sequence
ATGTCGCATAAGATCAGGATTGCCATCGCGCTTGCGGCATTCGCCGCCGGCTCTTTCATCGGTTTGGCGG
ATCCGGCCTTCGCCTCTTCAGGCGGCAGTCTGCCGTGGGAATCCCCGCTTCAGCAAATCCAGCAATCGAT
CACCGGGCCGGTTGCCGGCTTCATCGCACTCGCCGCAGTCGCGATCGCCGGCGGCATGCTGATCTTCGGG
GGCGAGTTGAATGATTTCGCAAGGCGGCTTTGCTACGTCGCCCTCGTTGGCGGCGTTCTGCTCGGCGCGA
CACAGATCATCGCCCTGTTCGGCGCAACTGGCGCTTCGATTGGCGAGATGGAGGCTCGAACCGGGCCTGG
GATCATCGAACCGGTAATGCTTCGCGCGCAAGGGGAGGGGGCCCATGGCTGA
 Primer design