SecReT4
Protein ID: 159161998
T4SS name [ID]VirB [19]
Gene symbolvirB7
Locus tagAtu6173
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid Ti [GenBank: NC_003065] [Browse all T4SS(s) in this replicon]
Location [Strand]189377..189544 [+]
Producttype IV secretion system lipoprotein VirB7
Component typeVirB7
UniProt IDP17797
KEGG IDatu:Atu6173
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|159161998|ref|NP_536093.1| component of type IV secretion system [Agrobacterium tumefaciens str. C58]
MKYCLLCLALALGGCQTNDKLASCKGPIFPLNVGRWQPTPSDLQLSNVGGRHEGV
 
Nucleotide Sequence: 168 bp     [Download]
>gi|159161952|ref|NC_003065.3|:189377-189544 Agrobacterium tumefaciens str. C58 plasmid Ti, complete sequence
ATGAAATATTGCCTGCTGTGCCTGGCTCTCGCTTTAGGCGGCTGCCAGACAAACGATAAATTGGCGAGCT
GCAAAGGCCCAATATTCCCGCTGAATGTGGGGCGATGGCAGCCTACGCCGTCAGATCTTCAGCTCAGCAA
CGTAGGTGGTCGCCATGAAGGGGTCTGA
 Primer design