SecReT4
Protein ID: 159186516
T4SS name [ID]VirB [218]
Gene symbolavhB1
Locus tagAtu5162
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]160508..161194 [+]
Producttype IV secretion protein AvhB1
Component typeVirB1
UniProt IDQ7D3S2
KEGG IDatu:Atu5162
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 228 a.a.     [Download]
>gi|159186516|ref|NP_396092.2| type IV secretion protein AvhB1 [Agrobacterium tumefaciens str. C58]
MPVVFSDFCQTFEPFLASDAVPGVAGFKSQLSPLDIRSDSSAPLGRPETKPEVIKVATSFPVERREMHIG
VEGIGPQELRRLNPSIPEAIELRLDQTSTGTQLDACFRVAVKVEAHPASGEQVPQSRRGRDDPSVGGVVN
YGDQVRREIERLGPTVARFTIGDTGKGLQTNVSANSSQADVVAEVVAENTPGEAHAISAASAWDVFKTRS
RSSVLVFQDNQLELEQSE
 
Nucleotide Sequence: 687 bp     [Download]
>gi|159186452|ref|NC_003064.2|:160508-161194 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGCCCGTTGTCTTCTCAGATTTTTGCCAGACCTTCGAGCCATTCCTTGCGTCGGACGCCGTTCCGGGTG
TTGCGGGCTTCAAAAGCCAATTGTCTCCGCTCGACATCAGGAGCGACAGCAGTGCGCCGCTCGGGCGGCC
TGAGACCAAGCCAGAGGTGATCAAAGTTGCCACATCCTTTCCGGTGGAACGCCGCGAGATGCACATTGGT
GTTGAAGGGATCGGGCCGCAAGAACTGCGCAGATTGAACCCCTCGATACCGGAAGCCATCGAACTCCGCC
TTGACCAGACGTCTACAGGAACGCAACTCGACGCCTGTTTTCGTGTCGCGGTGAAGGTGGAGGCGCACCC
TGCCTCGGGCGAGCAGGTGCCGCAATCCCGCCGCGGACGTGACGATCCGTCGGTCGGGGGCGTGGTCAAC
TATGGCGATCAGGTTCGCCGCGAAATCGAACGGCTCGGACCGACAGTGGCTCGATTTACAATCGGCGACA
CGGGAAAAGGGTTGCAGACAAACGTGTCGGCGAATTCTTCCCAAGCAGACGTTGTTGCCGAAGTGGTGGC
GGAAAACACTCCGGGGGAAGCACACGCGATCTCGGCGGCGTCCGCGTGGGACGTCTTCAAGACCCGAAGC
CGTTCATCCGTCCTGGTGTTTCAAGACAATCAATTGGAATTGGAGCAGAGTGAATGA
 Primer design