SecReT4
Protein ID: 159186517
T4SS name [ID]VirB [218]
Gene symbolavhB4
Locus tagAtu5165
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]161935..164208 [+]
Producttype IV secretion protein AvhB4
Component typeVirB4
UniProt IDQ7D3R9
KEGG IDatu:Atu5165
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 8.7e-62, Aligned region: 141..344
AAA_10 [PF12846], Evalue: 5e-31, Aligned region: 397..680
Protein Sequence: 757 a.a.     [Download]
>gi|159186517|ref|NP_396095.2| type IV secretion protein AvhB4 [Agrobacterium tumefaciens str. C58]
MVMVALAGVSFETADLLDINALHRDLNTLYRNIADERLAIWTHLIRRRDSDYPGGTFATPFSASLNEKYR
ERMAREHLFRNDLYLTVLWSPARSPADKAGKLLSYLRRSKRLDTELDEEALKELKDKVVIVMAGLRSFEP
RLLSLYEQEGMLFSEPSEVLHQLVGGRRERVPLTEGRVASAIYSDRVIIGRETIEIRHEAESRFAGMLSF
KEYPARTRTGMLDGVLNSPFELILSQSFCFVSKADARVIMGRKQNQLVSSGDKAASQIDELDDAMDDLES
NRFVLGEHHLTLSVFATTLKELTDNLAKVRASLTNGGAVVAREDLGLEAAWWAQLPGNFRYRARSGAISS
KNFAALSPFHSYPIGQKDGNEWGPAVALLKTASGSPYYFNLHYGDLGNTFMCGPSGAGKTVIVNFMLSQL
EKHDPHVVFFDKDRGADLYVRAAGGTYLPLKNGVPTGCAPLKALNLTPENKVFLARWIGKLVGSGARELT
VTELRDISGAIDGLADLPAERRTIGALRAFLNNTDPEGIAARLRRWEEGGPLGWVFDNVIEDIGFGDFGG
SGKFIGYDMTDFLDNEEIRIPLMAYLFHRVEQVIDGRRIIIVIDEFWKALQDEGFRDLAQNKLKTIRKQN
GLMLFATQSPRDALNSPIAHTIIEQCPTQIFLPNSRGNHADYVDGFKLTEREYELIARELSVESRRFVLK
QGHNSVVAELDLNGFDDELAILSGRTANVELLDAIRAEVGDDVENWLPIFQQRRSAS
 
Nucleotide Sequence: 2274 bp     [Download]
>gi|159186452|ref|NC_003064.2|:161935-164208 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGGTCATGGTCGCGCTCGCAGGCGTATCTTTCGAAACTGCTGATCTGCTCGACATCAACGCGCTCCATC
GCGATCTCAACACGCTCTATCGAAATATAGCCGATGAGCGGCTCGCGATCTGGACCCATCTCATTCGGCG
CAGGGATAGTGACTATCCGGGCGGAACGTTTGCAACGCCATTCTCCGCCTCGCTCAACGAGAAATACCGG
GAACGCATGGCACGCGAACACCTTTTCCGCAACGATCTCTATCTGACCGTCCTTTGGTCGCCAGCGCGTA
GCCCTGCGGACAAGGCGGGGAAGCTGCTGTCGTACCTTCGACGGTCAAAACGACTCGATACGGAGCTGGA
TGAAGAGGCTCTGAAAGAGCTTAAGGATAAAGTCGTCATTGTAATGGCGGGCTTGAGGAGCTTTGAGCCA
CGGCTCCTTTCTCTTTATGAACAGGAAGGCATGCTCTTCTCTGAACCGAGCGAGGTGCTGCACCAGCTCG
TCGGCGGGAGGCGTGAGCGCGTGCCGCTTACCGAAGGTCGCGTCGCGTCGGCAATTTACTCTGATCGCGT
CATCATAGGTCGGGAAACGATCGAGATCCGGCATGAGGCAGAAAGCCGCTTCGCCGGCATGCTGAGCTTC
AAGGAATATCCAGCCCGTACCAGGACAGGCATGCTGGACGGAGTTCTAAACAGTCCGTTTGAACTCATTC
TCTCACAGTCGTTCTGCTTTGTGTCGAAGGCGGACGCTCGCGTCATCATGGGGCGTAAGCAAAACCAGTT
GGTGAGCAGCGGCGACAAGGCGGCTTCGCAGATCGATGAACTTGACGATGCGATGGACGACCTGGAGTCC
AACCGCTTCGTGCTCGGTGAGCATCACCTGACACTCTCCGTCTTTGCGACCACTTTAAAGGAATTAACCG
ACAATCTGGCAAAGGTTCGCGCCAGCCTGACCAATGGCGGGGCTGTCGTTGCGCGCGAGGATCTTGGTCT
CGAAGCGGCATGGTGGGCGCAACTTCCGGGCAATTTTCGTTACCGCGCGCGCTCAGGCGCGATCAGCTCG
AAGAATTTCGCAGCATTGTCACCGTTCCATTCCTATCCGATCGGACAGAAGGACGGCAATGAGTGGGGAC
CCGCCGTCGCCCTGCTCAAGACCGCTTCAGGCTCGCCCTACTACTTCAATCTCCATTATGGCGATCTGGG
CAACACCTTCATGTGCGGTCCGTCGGGAGCGGGCAAAACCGTGATTGTCAATTTCATGCTGTCACAGCTC
GAGAAACACGACCCGCACGTGGTGTTCTTCGACAAGGATCGCGGCGCGGACCTTTATGTTCGCGCCGCCG
GAGGCACCTACCTGCCGCTGAAGAACGGGGTCCCCACCGGCTGCGCTCCCTTAAAGGCCCTCAACCTGAC
GCCGGAGAACAAGGTGTTCCTGGCGCGCTGGATCGGCAAGCTTGTGGGTTCAGGGGCGCGGGAACTGACT
GTCACCGAACTTCGCGACATCTCCGGCGCGATCGACGGCCTTGCCGACCTGCCCGCTGAGCGACGGACAA
TAGGGGCGCTGCGGGCTTTCCTCAACAATACGGATCCGGAAGGTATCGCGGCGAGGCTCCGCCGGTGGGA
AGAGGGAGGGCCGCTCGGCTGGGTCTTCGACAATGTCATCGAAGATATCGGATTTGGCGATTTCGGCGGA
TCAGGGAAGTTCATCGGCTACGACATGACCGACTTCCTCGACAACGAGGAAATTCGCATACCGCTGATGG
CCTATCTCTTCCATCGCGTCGAGCAGGTGATCGATGGCCGCCGGATCATCATCGTCATCGACGAATTCTG
GAAGGCGCTACAGGACGAGGGGTTCCGCGATCTTGCGCAAAACAAGCTGAAGACCATCCGCAAACAAAAT
GGGTTGATGCTGTTTGCCACGCAAAGCCCGCGCGACGCGCTGAACTCGCCAATCGCGCACACGATCATCG
AGCAATGCCCGACACAGATCTTCCTGCCCAACTCGCGCGGCAACCATGCCGACTATGTCGATGGATTCAA
GCTCACCGAGCGCGAATACGAATTGATAGCGCGCGAGCTTTCCGTTGAAAGCCGGAGGTTCGTGTTGAAG
CAAGGACACAACAGCGTCGTTGCCGAGCTCGATCTCAACGGCTTCGATGACGAGCTCGCCATCCTCTCCG
GCCGGACCGCCAATGTCGAACTTCTCGACGCGATCCGCGCGGAGGTTGGAGACGACGTCGAGAACTGGCT
TCCCATTTTCCAACAGCGAAGGAGTGCTAGCTGA
 Primer design