SecReT4
Protein ID: 159186518
T4SS name [ID]VirB [218]
Gene symbolavhB6
Locus tagAtu5167
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]165141..166076 [+]
Producttype IV secretion protein AvhB6
Component typeVirB6
UniProt IDQ7D3R7
KEGG IDatu:Atu5167
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7e-55, Aligned region: 39..260
Protein Sequence: 311 a.a.     [Download]
>gi|159186518|ref|NP_396097.2| type IV secretion protein AvhB6 [Agrobacterium tumefaciens str. C58]
MYQVFEFIDGQFKRPLEIFVSDGTSNIAEWVAGPLTVAVTLYVVLYGYLILRGSVQEPILDFAFRAMKLA
IIVMLVKNAGEYQTYVTNIFFDVLPREIAQALNAGTAPSASTFDSLLDKGQASATDIWTRASWPIDIVTG
VGGIMVIGVSFLVAGIGYVVSLYARLALAIVLAIGPIFIALAMFQSTRRFTESWIGQLANFVILQVLVVA
VGSLLISCLDSTFTAIDSYSDVLMRPIAFCAIGIAALYIFYQLPGIASALASGGASLVYGYTTARDAHEG
MLARAASHTGRMIGRGARFARRAFGSRNAGV
 
Nucleotide Sequence: 936 bp     [Download]
>gi|159186452|ref|NC_003064.2|:165141-166076 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGTACCAGGTGTTTGAGTTTATCGACGGTCAGTTCAAGCGGCCGTTGGAGATTTTCGTCTCGGATGGGA
CGTCGAACATAGCAGAATGGGTCGCTGGTCCGTTGACGGTGGCAGTGACCCTCTACGTCGTCCTCTACGG
CTATCTCATCCTTCGGGGCTCGGTCCAGGAACCTATCCTTGACTTCGCCTTCCGCGCGATGAAGCTCGCG
ATCATAGTGATGCTGGTGAAGAACGCGGGCGAATATCAGACCTATGTCACAAACATCTTCTTCGATGTTT
TGCCACGCGAGATCGCTCAGGCGCTGAATGCAGGTACGGCGCCGAGTGCCAGCACCTTTGACAGTCTGCT
CGACAAGGGCCAGGCCTCTGCGACCGATATCTGGACCAGGGCTTCCTGGCCGATTGACATCGTCACAGGT
GTGGGCGGCATCATGGTGATCGGCGTCAGCTTTCTGGTGGCGGGGATCGGTTATGTTGTTTCCCTTTATG
CACGGTTGGCGCTGGCGATCGTCCTGGCGATCGGGCCGATTTTCATTGCGCTTGCCATGTTTCAATCGAC
GCGCCGTTTTACCGAGTCCTGGATCGGGCAGCTCGCAAACTTCGTGATCCTTCAGGTCCTTGTCGTTGCC
GTCGGTTCGCTTTTGATCTCCTGCCTCGACTCGACCTTCACCGCAATCGACAGCTACAGCGACGTCCTTA
TGCGCCCTATTGCTTTTTGTGCCATCGGGATAGCTGCCCTGTACATATTCTACCAGCTACCTGGCATTGC
ATCGGCGCTGGCGTCTGGCGGCGCCTCGCTGGTCTATGGTTACACGACCGCACGCGATGCGCATGAAGGC
ATGCTGGCCAGAGCAGCCTCCCACACCGGCCGGATGATCGGTCGCGGTGCTCGGTTTGCCCGCCGCGCCT
TCGGATCAAGAAATGCCGGCGTATGA
 Primer design