SecReT4
Protein ID: 159186519
T4SS name [ID]VirB [218]
Gene symbolavhB9
Locus tagAtu5170
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]167053..167904 [+]
Producttype IV secretion protein AvhB9
Component typeVirB9
UniProt IDQ7D3R4
KEGG IDatu:Atu5170
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.2e-59, Aligned region: 30..254
Protein Sequence: 283 a.a.     [Download]
>gi|159186519|ref|NP_396100.2| type IV secretion protein AvhB9 [Agrobacterium tumefaciens str. C58]
MRIPRIPALIVTLSMSPAFALEIPRGASQDSRIRFVNYQPYNITRVVGTLRSSVQVEFAADEEIAHVALG
NSVAWEVAPAGNILFLKPRESQPVTNISVVTTRRDGSTRSYQMELTARDGSVEAGQNTYFYVKYRYPGDD
AELRRQQAASRALAAQAKDADNVLALHEAYGPRNWRYSSQGSQALEPQSVYDNGKITTFAFVGNQEMPAI
YMENSDGSESLVPKSVDGDLVMVHAISRKFILRRGKDVLCVFNEAYDRVGINPDTNTTSPSVERVVKRDV
TGQ
 
Nucleotide Sequence: 852 bp     [Download]
>gi|159186452|ref|NC_003064.2|:167053-167904 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGCGCATCCCTCGAATTCCTGCACTCATCGTGACCCTTTCGATGTCGCCGGCGTTTGCGCTTGAGATAC
CCCGAGGTGCCTCGCAAGACAGTCGTATCCGGTTCGTGAACTACCAACCCTACAACATCACGCGGGTGGT
CGGCACTCTGCGGTCATCCGTACAGGTCGAGTTCGCGGCGGACGAGGAAATCGCCCATGTCGCGCTCGGC
AATAGCGTCGCCTGGGAAGTTGCGCCGGCCGGCAACATCCTGTTCCTGAAGCCACGCGAGAGCCAGCCGG
TGACGAATATTTCCGTGGTTACGACGCGCAGGGATGGCTCGACCCGCAGCTACCAGATGGAACTGACGGC
GCGCGATGGCTCCGTGGAGGCTGGTCAAAACACCTACTTCTACGTGAAGTACAGGTATCCAGGCGATGAC
GCCGAGCTTCGCCGCCAGCAGGCAGCGTCGAGGGCTCTCGCGGCCCAGGCGAAGGACGCCGACAATGTGC
TGGCGCTTCACGAAGCCTATGGCCCCCGAAACTGGCGCTATTCTTCTCAGGGATCGCAGGCACTGGAGCC
GCAAAGCGTCTACGACAACGGCAAGATTACAACGTTCGCCTTTGTGGGTAACCAGGAAATGCCCGCGATC
TATATGGAGAACTCCGATGGCTCCGAAAGCCTTGTTCCGAAGTCGGTCGATGGAGATCTGGTGATGGTGC
ACGCGATCAGCCGCAAGTTCATCTTGCGTCGGGGCAAGGATGTGCTCTGCGTCTTCAACGAAGCCTACGA
CCGCGTCGGTATCAATCCTGACACCAACACAACGTCTCCTTCGGTGGAGCGCGTCGTGAAGCGCGACGTT
ACCGGGCAATAG
 Primer design