SecReT4
Protein ID: 15919977
T4SS name [ID]VirB [380]
Gene symboltraN
Locus tagD763_p1038
StrainPlasmid pSB102
Repliconplasmid pSB102 [GenBank: NC_003122] [Browse all T4SS(s) in this replicon]
Location [Strand]18527..21256 [-]
ProductTraN protein
Component typeVirD4
UniProt IDQ91UR9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-95, Aligned region: 101..264
T4SS-DNA_transf [PF02534], Evalue: 1.5e-95, Aligned region: 387..642
TraG-D_C [PF12696], Evalue: 9.7e-23, Aligned region: 483..607
TrwB_AAD_bind [PF10412], Evalue: 1e-10, Aligned region: 393..620
Ribosomal_L12 [PF00542], Evalue: 1.7e-05, Aligned region: 300..363
Protein Sequence: 909 a.a.     [Download]
>gi|15919977|ref|NP_361037.1| TraN protein [uncultured bacterium]
MEIPKWLKWLLGIVGFIAATAGAIWLSGFLFFAFSKTNPMGKTDFWTWWTYWQFYAADPVVAKRLKVALI
VAAVVAYGVPLVAIIAAMREVRSLHGDARFATAGEIAKAGLFAKTGIIVGKWGRRYLMYASMQFVLLAAP
TRSGKGVGIVIPNLLNWAESVVVLDVKLENFLITSKYRAKWGQEVFLFNPFSISEDADGNPLHGKTHRYN
PLGYVSDDPRLRVTDILAIGYSLYPGEGRDAFFDDAARNLFLGLTLYLCETPTLPRTMGELLRQSSGKGR
PVKEHIQGFITERNYREYGDLMLNDLGDDREAVVQAVMAIRGCDEAEAEALCDDVPVAVVENVRNTELDQ
FELLLSGAGAEFESDRRLVPLTVWDGEGLPMLSMECVDALNRFTSTSDNTLSSIMATLHVPLTIWASPIV
DAATSANDFDLRDVRKKRMSIYLGIPANKLSEAKLLLNMFYTQLVNLNTNQLLHSTPELKFTCLMLDDEF
TAPGRIGIIDKANSYMAGYGLRLLTIIQSPGQLEAESPKGYGRESARTFVTNHALQILYTPKEQRDANEY
SEMLGYMTVHSRNRSHGKSGSSVSEAEGEGAGQKRALMMPQELKEMSQRKQIISLENMKPIKCDKISYFS
DHAFMDRLKSVSPTLAALGKKLPSKKQLEDTWGSGELAAPVPDLNLDLHEAVVQSRVREMTVADVDKGID
LRALAVDTSKIAVVAGSDGLEPDEIEGFVNDFFDALDAADPNEYDDDAPVDDDGSGALPSDDELAALDAE
AEAEALAETNANTAAEEVPQAAPAAPKPEPKPKAKRKPKAAPAVAPVVAVAAVAEEVAVQADENLRHDEG
ELVADEPTDDELAAMMDDVFPDDGHLPDEADMLAALDEMEDVPDLPPELEDDAPILDLSVLDKPVSQNR
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|15919954|ref|NC_003122.1|:c21256-18527 Uncultured bacterium plasmid pSB102 complete genome
ATGGAAATCCCGAAGTGGCTCAAATGGTTACTCGGCATTGTCGGGTTCATCGCCGCGACGGCCGGGGCAA
TATGGCTGTCCGGCTTCCTGTTCTTCGCTTTCAGCAAGACGAACCCCATGGGGAAGACGGACTTCTGGAC
GTGGTGGACCTACTGGCAGTTTTACGCGGCCGATCCGGTCGTCGCGAAACGCCTCAAGGTCGCCTTGATC
GTCGCGGCCGTCGTTGCCTACGGGGTGCCCCTCGTCGCAATCATCGCGGCTATGCGGGAGGTTCGTTCGC
TCCATGGTGATGCGCGGTTCGCGACTGCCGGCGAGATTGCGAAAGCGGGCCTGTTCGCCAAAACCGGCAT
CATCGTCGGCAAGTGGGGCCGTCGATACCTGATGTACGCCAGCATGCAATTCGTGTTGCTGGCCGCCCCA
ACGCGAAGCGGTAAGGGTGTCGGGATCGTGATTCCGAACCTGCTCAATTGGGCGGAATCCGTCGTCGTGC
TCGATGTGAAGTTAGAAAACTTCCTCATCACGTCGAAGTATCGCGCCAAGTGGGGCCAAGAGGTCTTCCT
GTTCAACCCGTTCTCGATCAGCGAGGACGCGGACGGCAACCCGCTACACGGCAAGACGCATCGCTACAAC
CCCCTTGGCTATGTCAGCGACGATCCCCGCTTGCGGGTAACGGACATCCTGGCGATTGGCTATTCGCTGT
ATCCAGGCGAAGGCCGCGATGCGTTTTTCGATGATGCAGCTCGCAACCTGTTCCTGGGCCTGACGCTGTA
CCTGTGCGAAACCCCGACCTTGCCGCGCACCATGGGCGAATTGCTGCGGCAATCGTCCGGCAAGGGCCGG
CCGGTAAAAGAGCACATTCAAGGCTTCATCACCGAACGAAACTACCGCGAGTACGGCGACCTGATGTTGA
ACGACCTGGGCGACGACCGCGAAGCCGTCGTGCAGGCCGTCATGGCAATTCGAGGCTGCGACGAAGCCGA
GGCCGAAGCCCTGTGCGATGACGTGCCCGTGGCAGTCGTGGAGAACGTCAGGAACACCGAACTCGACCAA
TTCGAATTGCTGCTGAGTGGAGCCGGCGCGGAATTTGAATCCGACCGCCGCCTAGTTCCATTGACGGTGT
GGGACGGCGAAGGCTTGCCCATGCTGTCCATGGAATGCGTGGACGCTCTGAACCGCTTCACGTCCACCTC
GGACAACACGCTGTCGAGCATCATGGCGACGTTACACGTGCCGTTGACCATTTGGGCAAGCCCAATTGTC
GATGCAGCAACGAGCGCGAACGACTTCGACCTGCGCGACGTGCGCAAAAAGCGCATGTCGATCTACCTGG
GCATCCCGGCGAACAAGCTCTCTGAGGCCAAGCTTCTGCTGAACATGTTCTACACGCAGTTGGTCAACCT
CAACACAAACCAACTGCTGCACTCGACACCGGAGCTGAAATTCACCTGCCTGATGCTGGATGACGAATTC
ACGGCCCCTGGCCGGATCGGCATCATCGACAAGGCGAACTCCTACATGGCCGGTTACGGTCTGCGCCTGC
TGACCATCATCCAGTCGCCGGGCCAGCTCGAAGCGGAGTCGCCGAAAGGCTACGGCCGGGAGAGTGCCCG
CACGTTCGTAACGAACCATGCGCTGCAAATCCTCTACACGCCAAAGGAACAACGCGACGCCAACGAGTAT
TCAGAAATGCTCGGCTACATGACGGTGCATTCGCGCAACCGTAGCCACGGCAAGAGTGGGTCCAGCGTCT
CCGAGGCCGAAGGCGAAGGCGCAGGGCAAAAACGAGCGCTGATGATGCCGCAGGAACTCAAGGAAATGAG
CCAGCGCAAGCAAATCATCAGCCTTGAGAACATGAAACCCATCAAATGCGACAAGATTTCCTATTTCTCG
GACCATGCTTTCATGGATCGGCTCAAGTCGGTTTCGCCGACTTTGGCCGCCCTGGGCAAAAAGCTGCCGT
CCAAAAAGCAGCTTGAGGACACATGGGGTTCGGGTGAGCTGGCCGCGCCCGTACCTGATTTGAACCTGGA
CCTGCACGAAGCCGTCGTGCAATCGCGTGTGCGTGAAATGACGGTTGCCGATGTAGACAAAGGCATCGAC
CTCCGGGCGCTTGCTGTCGATACCTCGAAAATTGCCGTAGTCGCCGGATCGGATGGCCTGGAACCTGACG
AAATTGAAGGTTTCGTGAACGACTTCTTCGACGCGCTCGATGCTGCCGATCCGAACGAATACGACGACGA
TGCTCCGGTCGATGATGACGGCTCGGGCGCGCTGCCAAGTGACGACGAACTTGCCGCCCTGGATGCCGAG
GCGGAAGCGGAAGCGCTCGCGGAAACCAACGCGAACACGGCCGCCGAGGAAGTGCCCCAGGCTGCGCCGG
CCGCGCCAAAACCGGAACCAAAGCCCAAGGCGAAACGAAAACCGAAGGCAGCGCCTGCCGTTGCGCCCGT
CGTCGCCGTGGCCGCAGTTGCTGAGGAAGTCGCCGTGCAGGCTGATGAAAATCTTCGTCATGACGAAGGT
GAGCTTGTCGCCGATGAGCCGACCGATGACGAACTGGCGGCCATGATGGATGACGTTTTTCCTGACGACG
GTCACTTGCCCGACGAAGCGGACATGCTCGCCGCCCTGGACGAAATGGAAGACGTTCCAGACCTGCCGCC
CGAGCTTGAAGACGACGCGCCCATACTGGATTTGAGCGTTCTTGACAAGCCAGTGAGCCAAAACAGATAA
 Primer design