SecReT4
Protein ID: 15919979
T4SS name [ID]VirB [380]
Gene symboltraM
Locus tagD763_p1039
StrainPlasmid pSB102
Repliconplasmid pSB102 [GenBank: NC_003122] [Browse all T4SS(s) in this replicon]
Location [Strand]22069..23145 [-]
ProductTraM protein
Component typeVirB11
UniProt IDQ91UR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.9e-69, Aligned region: 28..330
Protein Sequence: 358 a.a.     [Download]
>gi|15919979|ref|NP_361039.1| TraM protein [uncultured bacterium]
MSQLNNSNEYLAGNGAVQRATSVNFHLEVVNIWMADPAITEVCVNRPGEIWCERQSVWETHKVDALTFDH
CQSLATATAKFANQDITDSRPILSAVLPAGERVQIVMPPAAEHGTISVTIRKPSFSRRTLTDYEEQGFFK
HIRPMNGELSPDEHELLALKQAGDYVGFLRRAVQLEKVIVVAGETGSGKTTLMKALMQAIPTSQRIITIE
DVPELFLPDHPNHVHLFYPSEAKEEENAPVTAASLLKSCLRMKPTRILLAELRGGETFDFVNVCASGHGG
SITSLHAGSCDMAFERMALMMLQNRQGRTLPYNVIKRLLYQVVDIVIHVHNDVYHPELGRHITELWYEPT
MKRAKAGA
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|15919954|ref|NC_003122.1|:c23145-22069 Uncultured bacterium plasmid pSB102 complete genome
ATGTCGCAGCTCAATAATTCGAACGAATATCTCGCTGGCAACGGTGCGGTACAGCGAGCGACTTCGGTTA
ACTTCCATCTGGAAGTGGTCAACATATGGATGGCCGATCCGGCTATCACCGAAGTGTGCGTGAACCGGCC
GGGTGAAATCTGGTGCGAACGGCAAAGCGTGTGGGAAACCCACAAGGTTGACGCTTTGACGTTCGATCAC
TGCCAATCCCTGGCAACCGCGACCGCGAAGTTCGCCAATCAAGACATCACCGATTCCCGGCCGATCCTTT
CGGCCGTGCTGCCTGCTGGTGAGCGTGTGCAAATCGTGATGCCACCAGCGGCAGAACACGGGACGATTTC
GGTCACGATCCGAAAGCCGTCCTTCTCCCGTCGCACGCTGACCGACTATGAAGAGCAAGGCTTCTTCAAG
CACATTCGGCCAATGAATGGCGAGTTGTCGCCGGACGAACATGAACTGCTAGCCCTCAAGCAAGCCGGCG
ATTACGTCGGCTTCCTGCGTCGGGCGGTCCAGCTCGAAAAAGTCATTGTCGTGGCCGGCGAAACTGGCTC
GGGCAAGACCACGCTCATGAAGGCGTTGATGCAGGCGATTCCGACCTCACAGCGCATCATCACGATTGAA
GACGTGCCCGAGTTGTTCTTGCCGGATCACCCGAACCACGTTCACCTGTTCTACCCGAGCGAAGCCAAGG
AAGAAGAAAACGCACCGGTAACGGCTGCATCGTTGCTGAAAAGCTGCCTGCGGATGAAACCGACGCGCAT
TCTCCTGGCTGAGCTGCGCGGCGGCGAGACGTTCGATTTCGTCAACGTCTGCGCCTCCGGTCACGGGGGA
AGCATCACCAGTCTGCATGCTGGGTCGTGTGACATGGCTTTCGAGCGCATGGCTCTGATGATGTTGCAGA
ACCGGCAGGGTCGTACCCTGCCCTACAACGTCATCAAGCGGCTGCTCTATCAGGTCGTGGACATCGTGAT
TCACGTCCACAACGACGTGTATCACCCTGAACTCGGTCGTCACATTACCGAACTTTGGTACGAACCAACG
ATGAAACGCGCCAAAGCGGGCGCGTGA
 Primer design