SecReT4
Protein ID: 15919982
T4SS name [ID]VirB [380]
Gene symboltraJ
Locus tagD763_p1042
StrainPlasmid pSB102
Repliconplasmid pSB102 [GenBank: NC_003122] [Browse all T4SS(s) in this replicon]
Location [Strand]25164..25889 [-]
ProductTraJ protein
Component typeVirB8
UniProt IDQ91UR4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.6e-67, Aligned region: 28..235
Protein Sequence: 241 a.a.     [Download]
>gi|15919982|ref|NP_361042.1| TraJ protein [uncultured bacterium]
MFRRKKAAGDEVTPPNAVQAKDPFEQENNWEASRTQAIEKSEQRAWYVAYGAVGVAVLSWLAIVLMMPLK
ETIPYVIRVDNTTGVPDIVTALNSKGVGYEEVMDKYWLAQFVRARETYDWYTLQKDYNTVGLLASPNVGK
DYAALFEGPEALDKKFGKSVRATVEIVSVVPNGRGVGTVRFIKTTKRTDDDGPGTVTKWVATVAYEYRNP
SLISESQRLVNPFGFQVLSYRQDPEMVGGGQ
 
Nucleotide Sequence: 726 bp     [Download]
>gi|15919954|ref|NC_003122.1|:c25889-25164 Uncultured bacterium plasmid pSB102 complete genome
ATGTTCAGACGCAAAAAGGCGGCGGGTGACGAAGTGACCCCGCCGAATGCCGTCCAGGCCAAAGACCCGT
TCGAGCAAGAAAACAATTGGGAAGCCTCGCGCACCCAAGCTATCGAAAAGTCAGAGCAACGGGCGTGGTA
CGTGGCCTATGGAGCCGTAGGGGTAGCGGTGCTGTCTTGGCTCGCTATCGTCTTGATGATGCCGCTCAAG
GAAACCATTCCCTACGTCATTCGCGTGGATAACACCACGGGCGTTCCTGACATCGTGACCGCCCTCAACA
GCAAGGGCGTCGGCTATGAGGAAGTGATGGACAAGTATTGGCTGGCCCAATTTGTCCGCGCCCGTGAAAC
ATACGACTGGTACACGCTCCAGAAGGACTACAACACCGTGGGGCTGCTGGCCTCGCCAAACGTTGGCAAG
GACTACGCCGCTCTGTTCGAAGGCCCCGAAGCCCTCGACAAGAAGTTTGGCAAATCGGTACGGGCCACGG
TTGAGATTGTGAGCGTCGTTCCCAATGGTCGCGGCGTTGGCACCGTGCGATTCATCAAGACCACCAAACG
CACCGATGATGACGGTCCAGGCACCGTCACGAAGTGGGTTGCGACCGTTGCATACGAATACCGCAACCCG
TCGCTTATCTCGGAATCGCAGCGTCTGGTGAACCCGTTCGGGTTCCAGGTGCTGAGCTATCGCCAAGACC
CTGAAATGGTCGGGGGTGGACAATGA
 Primer design