SecReT4
Protein ID: 15919983
T4SS name [ID]VirB [380]
Gene symboltraI
Locus tagD763_p1043
StrainPlasmid pSB102
Repliconplasmid pSB102 [GenBank: NC_003122] [Browse all T4SS(s) in this replicon]
Location [Strand]25893..26069 [-]
ProductTraI protein
Component typeVirB7
UniProt IDQ91UR3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 58 a.a.     [Download]
>gi|15919983|ref|NP_361043.1| TraI protein [uncultured bacterium]
MKRALVLLMLATALAGCATNRPSVLPQLEGKPRVPINKQAPTPIKAATPSPVIDFKGE
 
Nucleotide Sequence: 177 bp     [Download]
>gi|15919954|ref|NC_003122.1|:c26069-25893 Uncultured bacterium plasmid pSB102 complete genome
ATGAAACGCGCTTTAGTCCTTCTCATGCTCGCGACCGCTCTCGCTGGATGCGCGACCAATCGGCCGTCCG
TGCTTCCCCAACTGGAAGGGAAACCGCGCGTGCCAATCAACAAGCAAGCTCCGACGCCGATCAAAGCGGC
GACGCCTTCACCCGTCATTGATTTCAAAGGGGAGTAA
 Primer design