SecReT4
Protein ID: 15923389
T4SS name [ID]Tra_Tn [643]
Gene symbol-
Locus tagSAV0399
StrainStaphylococcus aureus subsp. aureus Mu50
Repliconchromosome [GenBank: NC_002758] [Browse all T4SS(s) in this replicon]
Location [Strand]442161..443123 [-]
Producthypothetical protein
Component typeOrf13_Tn
UniProt IDQ932I7
KEGG IDsav:SAV0399
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 8.1e-59, Aligned region: 94..320
Protein Sequence: 320 a.a.     [Download]
>gi|15923389|ref|NP_370923.1| hypothetical protein SAV0399 [Staphylococcus aureus subsp. aureus Mu50]
MLFITKKGMNQMIIKIERKEKKEKPKKSKKPSKQRKVPMIKVGTHKKLTFVLWVLLIGSVGFGIYKNFTA
IDTHTVRETEIIKQQIVDTNQVESFVKSFAKDYFSWQQSQEAIDKRNEKLTHYLTEELQVLNEEMIRKDI
PTSSSVNDIQVWQVSQVNENTFEVLFSVEQVITEDKDKETISSSFHVVVHIDESDNMVIIKNPTMSKKPQ
KSDYQPKQLESDHTVDTETMDEITSFLETFFQLYPTATEKELTYYVSNHVLPMINKEYVFEELVNPIFTR
KDNQVIVNVAVKYLDQETKATQISQFELILEKQDNWKIVK
 
Nucleotide Sequence: 963 bp     [Download]
>gi|57634611|ref|NC_002758.2|:c443123-442161 Staphylococcus aureus subsp. aureus Mu50 chromosome, complete genome
GTGTTATTCATAACTAAGAAAGGAATGAATCAAATGATTATAAAAATCGAGCGAAAAGAAAAGAAGGAGA
AACCAAAGAAATCTAAAAAACCGAGCAAGCAAAGAAAAGTTCCGATGATTAAAGTTGGCACGCATAAGAA
ATTAACCTTTGTTTTATGGGTTTTATTGATTGGTAGTGTCGGATTTGGAATCTATAAAAATTTTACTGCC
ATTGACACTCATACTGTCCGTGAAACAGAAATCATTAAACAGCAGATTGTCGATACCAACCAAGTAGAAA
GTTTTGTGAAATCCTTTGCGAAAGACTACTTTTCGTGGCAACAATCCCAAGAAGCCATTGATAAACGAAA
TGAAAAATTGACCCATTATTTGACGGAAGAATTGCAGGTATTAAATGAAGAAATGATTCGTAAGGATATT
CCTACTAGTTCTAGTGTGAACGATATACAGGTGTGGCAGGTTTCTCAAGTGAATGAGAACACCTTTGAGG
TACTGTTTTCTGTTGAACAAGTTATTACCGAAGACAAAGACAAGGAAACTATATCGTCTAGCTTTCATGT
GGTTGTCCATATAGATGAATCAGATAATATGGTTATTATCAAAAATCCGACAATGAGTAAGAAACCTCAA
AAATCGGACTACCAACCCAAACAGCTAGAAAGTGACCATACAGTAGATACAGAAACGATGGACGAAATCA
CTAGCTTTTTAGAAACGTTCTTCCAGCTCTATCCTACCGCCACAGAAAAAGAATTGACTTACTATGTAAG
TAATCATGTGTTACCTATGATTAACAAGGAATATGTTTTCGAGGAATTGGTGAATCCTATCTTTACCAGA
AAAGATAACCAAGTAATCGTGAATGTCGCTGTGAAATATTTAGATCAAGAAACAAAGGCAACCCAAATCT
CGCAATTTGAGTTGATATTAGAAAAACAAGATAATTGGAAGATTGTAAAATAA
 Primer design