SecReT4
Protein ID: 15923390
T4SS name [ID]Tra_Tn [643]
Gene symbol-
Locus tagSAV0400
StrainStaphylococcus aureus subsp. aureus Mu50
Repliconchromosome [GenBank: NC_002758] [Browse all T4SS(s) in this replicon]
Location [Strand]443107..444129 [-]
ProductNLP/P60 family lipoprotein
Component typeOrf14_Tn
UniProt IDQ932I6
KEGG IDsav:SAV0400
PDB ID4FDY
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 2.1e-61, Aligned region: 49..205
NLPC_P60 [PF00877], Evalue: 5.2e-28, Aligned region: 230..336
Protein Sequence: 340 a.a.     [Download]
>gi|15923390|ref|NP_370924.1| NLP/P60 family lipoprotein [Staphylococcus aureus subsp. aureus Mu50]
MKLKITVICSVVFSLFFFLLLFLVIFFADDTDSGENNKDSSIPQGGVTVSPEVLAHRPLIEKYGKEYGIE
DYVSYILAIMQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLTSAEQQGVDIDSVIQSYN
YGGGFLNYVRSHGKKYTYELAEQFSKEKSGGQKADYPNPIAIPVNGGWRYNYGNQFYVQLVSQYLTDTSP
TEFDDETVQVIMDEALKYEGFPYVFGGASPTTSFDCSGLIQWVYDKAGISLPRVAQDQYDATQEISMEEA
QAGDLIFFHSTYNAGTYVTHVAIYLEGNRFYHAGDPIGYGDLSSRYWQDHLIGARRVIHN
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|57634611|ref|NC_002758.2|:c444129-443107 Staphylococcus aureus subsp. aureus Mu50 chromosome, complete genome
ATGAAGCTAAAAATAACAGTGATTTGTAGTGTGGTCTTCTCTCTCTTCTTTTTTCTCTTATTATTCCTAG
TCATTTTCTTTGCAGATGATACGGACAGTGGCGAAAACAACAAGGATTCTTCTATTCCACAAGGCGGTGT
GACCGTTTCACCAGAAGTGTTGGCACACCGTCCGTTGATTGAAAAATATGGTAAGGAATATGGGATTGAA
GACTATGTTTCTTATATCTTAGCCATTATGCAAGTGGAATCGGGCGGTACAGCAGAAGATGTTATGCAAA
GTTCCGAATCTTTGGGTTTACCGCCCAACAGTTTGAGTACCGAAGAGTCCATCAAACAAGGGGTTAAATA
TTTCAGTGAATTATTAACCAGTGCAGAACAACAAGGAGTGGATATAGATTCTGTTATCCAATCTTATAAT
TATGGCGGTGGCTTTTTAAATTATGTGAGGAGTCATGGGAAAAAATATACCTATGAATTAGCCGAACAGT
TTTCTAAAGAGAAGTCGGGTGGTCAAAAAGCAGACTATCCCAATCCTATAGCCATACCTGTGAATGGTGG
TTGGCGATATAACTATGGAAATCAGTTTTATGTTCAGTTGGTTTCACAATACCTAACCGACACTTCCCCA
ACAGAATTTGATGATGAAACCGTGCAAGTCATTATGGACGAAGCCTTGAAATACGAAGGGTTTCCCTATG
TCTTTGGAGGGGCGTCGCCTACCACCTCTTTTGATTGTAGTGGCTTAATACAATGGGTGTATGACAAAGC
TGGCATTTCTCTCCCTCGTGTCGCCCAAGATCAGTATGACGCTACGCAAGAAATCTCTATGGAAGAAGCC
CAAGCAGGCGACCTTATCTTCTTTCATTCAACCTATAATGCAGGCACATATGTGACTCATGTGGCGATAT
ATTTAGAGGGAAATCGCTTTTATCATGCAGGCGACCCAATCGGTTATGGCGACTTAAGCAGTCGTTATTG
GCAAGACCATCTGATTGGGGCTAGACGTGTTATTCATAACTAA
 Primer design