SecReT4
Protein ID: 15923391
T4SS name [ID]Tra_Tn [643]
Gene symbol-
Locus tagSAV0401
StrainStaphylococcus aureus subsp. aureus Mu50
Repliconchromosome [GenBank: NC_002758] [Browse all T4SS(s) in this replicon]
Location [Strand]444126..446153 [-]
Producthypothetical protein
Component typeOrf15_Tn
UniProt IDQ932I5
KEGG IDsav:SAV0401
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 675 a.a.     [Download]
>gi|15923391|ref|NP_370925.1| hypothetical protein SAV0401 [Staphylococcus aureus subsp. aureus Mu50]
MTQKQKKFLHYSWITLLCVGVILLLLGTLGNAVQATGLVDETIDTSNEYSKYGLNQYQLDYYVDNSWGWL
PWNWSDGIGQSVMYGLYAITNFIWTISLYLSNATGYLVKEAYALDFISQTSQAIGENMQTIAGITPNGFS
SSGFYVGFLLLFILIVGIYVAYTGLVKRETTKVIRAVLNFVVVFILSASFIAYAPDYIAKINDFSKDVST
ASLNIGTKIVLPNTDSQGKDSVDMIRDSLFSVQVKQPWLLLQYGSTDVEALGEERVESLLSTSPDTNNGE
DRENVVIEEIEDHDNTYLTLPKTISRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFIIFAMFLPISFL
LSMLPSFDGMGRHAITKLFNVIMTRAGITLIITVAFSISTMLYSLSASSPFFMIMFLQIVTFAGIYFKLG
DLMSLFTLQSNDSQNMGRQVFRRPRQMMNRQTRRFQRSMSKIFRGKAGSTKQKTMTTKQNQTNKANHTRQ
NERTTPKKETALSNVKKQQGGIGQRLGEKTAHVLDTKNRLVNKRKQAKQQIQATPTHVKYALHQGKENVT
HNVTDFKQSMADTKAQRKQQRMNQQEQKRKNIAQKRLELDKAKEKRRKENPSSPVQNNQQHVRKRQQTVT
PVLSQNTKRENHQRPLKKEQKQKTPPKQFNQRKLNKRTDKRGQQT
 
Nucleotide Sequence: 2028 bp     [Download]
>gi|57634611|ref|NC_002758.2|:c446153-444126 Staphylococcus aureus subsp. aureus Mu50 chromosome, complete genome
ATGACACAAAAACAAAAGAAATTTCTTCACTATAGTTGGATAACGCTCCTTTGTGTGGGCGTTATTTTAC
TTTTATTAGGCACGCTGGGCAATGCAGTACAAGCGACAGGCTTAGTTGATGAAACCATTGATACAAGCAA
TGAATACTCCAAGTATGGTTTGAATCAATATCAGCTTGATTATTATGTGGACAATAGCTGGGGCTGGCTT
CCATGGAATTGGAGTGATGGCATAGGACAATCGGTGATGTATGGATTGTATGCCATTACTAATTTTATTT
GGACAATTTCTCTTTATCTATCGAACGCCACAGGTTATTTGGTGAAAGAAGCCTATGCCTTAGATTTCAT
TAGTCAAACATCCCAAGCAATTGGCGAAAACATGCAGACGATTGCAGGCATTACACCGAATGGCTTTTCC
AGTTCAGGGTTTTATGTCGGTTTCCTCCTTCTTTTTATTCTCATTGTTGGAATCTATGTTGCCTATACAG
GATTGGTTAAGCGAGAAACGACGAAAGTGATACGAGCTGTTTTAAACTTTGTCGTGGTGTTTATTCTATC
GGCTTCCTTTATTGCGTATGCACCCGATTATATTGCGAAAATCAATGATTTTTCCAAAGATGTCAGTACC
GCCAGTCTGAATATTGGGACAAAAATTGTTCTTCCTAACACGGATAGTCAAGGGAAAGACAGTGTGGACA
TGATACGTGACAGCTTATTCTCTGTTCAAGTAAAGCAACCATGGCTATTGCTTCAATATGGCTCCACTGA
TGTAGAAGCGTTAGGGGAAGAACGTGTGGAAAGTTTATTGTCTACCAGTCCAGATACAAACAATGGTGAA
GATAGAGAAAATGTAGTGATTGAAGAAATTGAAGATCATGACAATACCTATTTAACCCTACCGAAGACGA
TTTCCAGATTAGGAACAGTCTTCTTTTTGTTTGTATTCAATATTGGTATCTCGATTTTTGTTTTCCTTCT
AACAGGAATCATGATTTTTTCGCAAGTGCTATTTATTATTTTCGCTATGTTTTTGCCAATCAGTTTCCTA
TTAAGTATGTTGCCGAGTTTTGATGGCATGGGCAGGCATGCCATTACCAAGTTATTTAATGTGATTATGA
CAAGGGCTGGTATTACCTTGATTATTACCGTTGCCTTTAGTATTTCCACTATGCTTTATTCGCTGTCAGC
AAGTTCTCCCTTTTTCATGATTATGTTTTTACAAATTGTGACCTTTGCAGGGATTTATTTTAAACTGGGC
GATTTAATGAGCCTATTCACTTTACAAAGCAACGACTCTCAAAACATGGGCAGACAAGTGTTTCGCAGAC
CTCGTCAAATGATGAATCGACAAACCAGAAGATTTCAACGCAGTATGAGTAAGATTTTTCGTGGAAAAGC
AGGGTCAACGAAGCAAAAGACAATGACAACAAAGCAGAATCAAACCAATAAAGCTAACCATACTCGTCAA
AATGAACGGACTACACCAAAGAAAGAAACAGCACTTTCCAATGTGAAAAAGCAACAAGGCGGTATCGGGC
AACGATTAGGTGAAAAGACAGCCCATGTATTGGACACGAAAAATCGTCTAGTCAATAAAAGAAAGCAGGC
AAAACAACAGATACAGGCGACACCAACCCATGTCAAATATGCCCTTCATCAAGGAAAAGAGAATGTCACT
CATAATGTAACAGACTTTAAACAATCTATGGCAGATACCAAAGCTCAACGCAAACAACAGCGTATGAACC
AGCAGGAGCAAAAACGAAAGAACATTGCTCAAAAGCGTTTGGAGCTGGATAAAGCAAAAGAAAAAAGACG
AAAAGAAAACCCATCATCTCCTGTTCAGAATAACCAGCAGCATGTTCGCAAGCGTCAGCAAACCGTCACG
CCTGTTTTGTCACAAAACACTAAACGTGAAAATCATCAGCGACCATTGAAAAAAGAGCAAAAACAAAAGA
CACCACCGAAGCAATTCAATCAGAGGAAGCTAAATAAAAGAACGGATAAGCGAGGACAACAAACATGA
 Primer design