SecReT4
Protein ID: 15923392
T4SS name [ID]Tra_Tn [643]
Gene symbol-
Locus tagSAV0402
StrainStaphylococcus aureus subsp. aureus Mu50
Repliconchromosome [GenBank: NC_002758] [Browse all T4SS(s) in this replicon]
Location [Strand]446150..448603 [-]
ProductATP/GTP-binding protein
Component typeOrf16_Tn
UniProt IDQ932I4
KEGG IDsav:SAV0402
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.6e-34, Aligned region: 468..763
Protein Sequence: 817 a.a.     [Download]
>gi|15923392|ref|NP_370926.1| ATP/GTP-binding protein [Staphylococcus aureus subsp. aureus Mu50]
MAYPIKYMEDNLVFNHDGEVFAYYELIPYNYSFLSSDEKIQVHDNFCQLIAQNRDGKIHALQLATESSIR
ATQEQSKKEITGRLKEIAYEKIDEQTEALISMIGDNQVDYRFFIGFKLYLNEQEVSVKNVGKEIQKAFAE
FFHGVNHKLMGDFVSMPMAEIERFSKMEQLLESKLSRRFQIRKLEKDDFGYIIEHLYGQTGVPFDDYDYH
LPKRYEDKKVLVKKYDILKPTRCLIEENQRYLRIEQEDTTTYVAYFTINSIVGELDFPNSEIFYYQQQQF
TFPVDTSMNVEIVANKKALSTVRNKKKELKDLDSHAWESDNETSTNVVDALESVDELESNLDQTKESMYK
LSYVVRVSAKNLDELKQRCDEVKDFYDDLSIKLVRPFGDMLGLHNEFIPSSKRYINDYIQYVTSDFLAGL
GFGATQMIGENSGIYVGYNLDTGRNIYLQPSLASQGIKGSVTNALASAFIGSLGGGKSFSNNMLVYYSVL
FGGQATIVDPKAERGEWKETLPDIAHEINIVNLTSENDNKGLLDPYVILKLPKDSESLAIDILTFLTGIS
SRDSEKFPVLRKAIRSVTQSKQRGLLLVIDELRKEDTPISNSIADHIESFVDYDFAHLLFSDGSVTQSIS
LEKQLNIIQVADLVLPDSNSSFEEYTTMELLSVAMLIVISTFALDFIHSDRSIFKIVDLDEAWSFLQVAQ
GKALSMRLVRAGRAMNAGVYFVTQNADDLLDEKMKNNIGLKFAFRSTDLVEIKKTLEFFGVDKEDENNQK
RLRELENGQCLVSDIYGRVGVMQFHPIFEELLHAFDTRPPVRNEVEE
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|57634611|ref|NC_002758.2|:c448603-446150 Staphylococcus aureus subsp. aureus Mu50 chromosome, complete genome
ATGGCATATCCGATTAAATATATGGAAGATAATCTCGTATTTAATCATGATGGCGAAGTATTCGCTTATT
ATGAATTAATTCCCTATAATTACAGTTTTTTAAGTTCCGATGAAAAAATTCAAGTTCATGATAATTTCTG
TCAATTGATTGCCCAAAATCGTGATGGCAAGATTCATGCTCTGCAACTAGCAACCGAATCAAGTATTCGA
GCCACACAGGAACAATCGAAAAAAGAAATCACTGGACGATTAAAAGAGATAGCTTACGAAAAAATAGATG
AACAGACCGAAGCGTTAATTTCTATGATTGGTGACAATCAAGTAGACTATCGCTTTTTTATTGGTTTTAA
ACTCTACCTCAATGAACAGGAAGTATCCGTAAAAAATGTTGGGAAAGAAATTCAAAAAGCATTTGCGGAA
TTCTTTCATGGTGTGAATCACAAATTAATGGGCGATTTTGTTTCTATGCCTATGGCGGAAATCGAACGCT
TTTCTAAGATGGAACAGTTGTTAGAAAGTAAATTATCCAGACGCTTTCAGATTCGTAAATTGGAGAAAGA
TGATTTTGGTTATATTATTGAACATCTTTACGGGCAAACAGGTGTCCCTTTTGATGACTACGACTACCAT
TTACCGAAACGATACGAAGATAAAAAAGTGTTGGTAAAGAAATACGATATTCTCAAACCCACTCGCTGTT
TAATCGAAGAAAATCAACGCTATTTACGGATTGAACAGGAAGATACCACTACTTATGTGGCGTATTTTAC
AATTAATAGTATTGTTGGTGAATTGGATTTCCCTAATAGTGAAATTTTTTATTACCAGCAACAGCAGTTT
ACTTTCCCCGTTGATACCAGTATGAATGTTGAAATTGTCGCCAATAAAAAAGCCTTATCTACCGTTCGCA
ATAAAAAGAAAGAACTGAAAGATTTAGATAGCCACGCATGGGAAAGCGACAACGAAACCAGTACTAATGT
GGTGGACGCTTTAGAATCTGTCGATGAATTAGAAAGTAATTTAGACCAAACCAAAGAATCTATGTACAAA
CTAAGCTATGTGGTACGGGTATCAGCAAAGAATTTGGACGAGCTGAAACAACGTTGTGATGAAGTAAAAG
ATTTTTATGATGATCTGTCTATCAAATTAGTACGACCTTTTGGCGATATGCTAGGCTTGCATAATGAATT
TATTCCCTCAAGCAAGCGATATATCAATGACTATATTCAATATGTCACGTCGGATTTTTTGGCTGGTCTT
GGTTTCGGTGCTACACAAATGATTGGTGAAAATTCTGGTATTTACGTCGGTTACAATCTCGATACAGGCA
GAAATATTTATCTCCAACCTAGCCTTGCAAGTCAAGGAATTAAAGGCTCTGTAACAAATGCATTAGCGTC
CGCTTTTATTGGTTCATTAGGTGGCGGAAAATCATTCTCTAACAATATGCTGGTCTATTATTCAGTACTC
TTTGGCGGACAGGCAACCATTGTTGACCCAAAAGCTGAACGTGGTGAATGGAAAGAAACCTTACCTGATA
TTGCCCATGAAATCAATATTGTTAATCTCACGAGTGAGAACGACAATAAAGGGTTACTTGACCCTTATGT
GATTTTAAAACTCCCGAAAGATTCAGAAAGCCTTGCCATTGATATTCTCACGTTCTTAACAGGTATTTCC
AGCCGAGATAGCGAGAAGTTTCCTGTCCTGCGTAAAGCTATTCGGAGTGTAACTCAAAGCAAACAACGAG
GGTTGTTATTGGTGATTGATGAATTGCGAAAAGAAGATACGCCCATCAGCAATAGTATTGCTGACCATAT
CGAAAGCTTTGTCGATTATGATTTTGCCCATCTGTTATTCAGTGATGGCAGTGTCACCCAATCCATTAGC
TTGGAAAAACAACTCAATATTATTCAAGTGGCAGATTTGGTCTTACCCGATTCCAATAGCTCTTTTGAAG
AATACACTACCATGGAATTATTAAGTGTGGCAATGCTGATTGTCATTAGTACCTTTGCTTTAGACTTTAT
CCACTCTGACCGTTCCATTTTTAAAATTGTTGACCTTGATGAGGCTTGGAGTTTTTTACAAGTGGCACAA
GGAAAAGCTCTATCTATGCGATTGGTTCGAGCAGGACGTGCCATGAATGCAGGGGTCTATTTCGTTACTC
AAAACGCGGACGATTTACTAGATGAAAAGATGAAGAATAATATTGGCTTGAAATTTGCCTTTCGTTCCAC
TGACCTAGTGGAAATCAAAAAGACCTTAGAATTTTTTGGTGTGGACAAGGAAGATGAAAACAATCAGAAA
CGCTTACGTGAATTAGAAAATGGACAATGTTTAGTTTCAGACATCTATGGTCGTGTAGGGGTTATGCAGT
TTCACCCGATTTTTGAAGAGTTGCTTCATGCCTTTGATACCAGACCGCCTGTGCGAAATGAGGTGGAAGA
ATGA
 Primer design