SecReT4
Protein ID: 15923393
T4SS name [ID]Tra_Tn [643]
Gene symbol-
Locus tagSAV0403
StrainStaphylococcus aureus subsp. aureus Mu50
Repliconchromosome [GenBank: NC_002758] [Browse all T4SS(s) in this replicon]
Location [Strand]448587..449024 [-]
Producthypothetical protein
Component typeOrf17_Tn
UniProt IDQ932I3
KEGG IDsav:SAV0403
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 1.7e-32, Aligned region: 20..119
Protein Sequence: 145 a.a.     [Download]
>gi|15923393|ref|NP_370927.1| hypothetical protein SAV0403 [Staphylococcus aureus subsp. aureus Mu50]
MIVLFLFLRKGREDMKKIRSYTSIWSVEKVIYAINDLQLPFPITFTQMTWFIVSLFVVILFGSLPPLSLI
DGALLKYLGIPIVLTGFMCQKTFDGKKPYGFLKSIITYALRPKVTYAGKQIRLKKETMNESITIVRSEQL
DGISD
 
Nucleotide Sequence: 438 bp     [Download]
>gi|57634611|ref|NC_002758.2|:c449024-448587 Staphylococcus aureus subsp. aureus Mu50 chromosome, complete genome
TTGATTGTTCTTTTTCTATTTTTACGGAAAGGACGTGAAGACATGAAAAAAATAAGAAGTTACACCAGTA
TTTGGTCAGTAGAAAAAGTGATTTATGCGATTAATGATTTACAACTCCCTTTCCCAATTACCTTTACGCA
AATGACATGGTTTATCGTTTCTTTGTTTGTCGTCATACTCTTTGGCAGTTTACCACCACTTTCTCTGATT
GACGGAGCACTACTCAAATACTTAGGGATTCCCATTGTTCTCACTGGGTTCATGTGCCAAAAGACCTTTG
ACGGAAAGAAACCCTATGGATTTCTAAAGTCTATCATTACCTATGCTCTACGCCCTAAAGTAACCTACGC
TGGCAAACAAATACGATTAAAAAAAGAAACAATGAATGAATCGATTACGATTGTAAGGAGTGAACAACTA
GATGGCATATCCGATTAA
 Primer design