SecReT4
Protein ID: 15923397
T4SS name [ID]Tra_Tn [643]
Gene symbol-
Locus tagSAV0407
StrainStaphylococcus aureus subsp. aureus Mu50
Repliconchromosome [GenBank: NC_002758] [Browse all T4SS(s) in this replicon]
Location [Strand]451130..451351 [-]
Producthypothetical protein
Component typeOrf19_Tn
UniProt IDQ932H9
KEGG IDsav:SAV0407
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|15923397|ref|NP_370931.1| hypothetical protein SAV0407 [Staphylococcus aureus subsp. aureus Mu50]
MNFGQNLYNWFLDNAQSLVLLAIVVIGLFLGFKREFSKLIGFLIIALIAVGLVFNAAGVKDVLLNLFNRI
IGA
 
Nucleotide Sequence: 222 bp     [Download]
>gi|57634611|ref|NC_002758.2|:c451351-451130 Staphylococcus aureus subsp. aureus Mu50 chromosome, complete genome
ATGAATTTTGGGCAGAATTTGTACAACTGGTTCTTGGATAATGCACAGTCATTGGTATTGTTAGCGATTG
TTGTCATTGGACTGTTTTTAGGTTTTAAACGAGAATTTTCAAAACTCATTGGCTTCTTGATTATTGCTCT
AATCGCCGTCGGACTTGTGTTCAATGCAGCTGGCGTGAAAGATGTGTTATTAAACTTATTTAACCGAATC
ATTGGTGCTTAA
 Primer design