SecReT4
Protein ID: 15923399
T4SS name [ID]Tra_Tn [643]
Gene symbol-
Locus tagSAV0409
StrainStaphylococcus aureus subsp. aureus Mu50
Repliconchromosome [GenBank: NC_002758] [Browse all T4SS(s) in this replicon]
Location [Strand]453000..454403 [-]
ProductFtsK/SpoIIIE family protein
Component typeOrf21_Tn
UniProt IDQ932H7
KEGG IDsav:SAV0409
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 8e-34, Aligned region: 192..369
AAA_10 [PF12846], Evalue: 8.4e-08, Aligned region: 227..264
DUF87 [PF01935], Evalue: 3.9e-07, Aligned region: 227..264
Protein Sequence: 467 a.a.     [Download]
>gi|15923399|ref|NP_370933.1| FtsK/SpoIIIE family protein [Staphylococcus aureus subsp. aureus Mu50]
MPLLHDRGERIKANDKHLVYHFVLISLLVVFLVVLLPFHWRALQSVNWQAVQLDTFFYQLHTPYFWSSIL
TALFVCGLISWLYYHYRIDSIKQLEHRQKLARMILENHWYEAEETQSEGFFKDLPSKKTKQRIRHFPKIY
YRMKDGLIHIHVEITLGKYQDQLLHLENKLETGLYCELVEKTLKDSYVEYVLLYDTIGNRIGIEDVVAQD
GRVKLMESVYWEFDSLPHMLIAGGTGSGKSYFILTLIESLLHTNAKLYILDPKNADLADLGAVMNNVYYR
KEDMLACINQFYEDMIDRSETMKQHPNYKTGENYAYLGLSANFLIFDEYVAMMDMLGRESTTVIHKLKQI
VMLGRQAGFFLILACQRPDAKYFSDGIRDNFNFRVALGRMSEMGFGMMFGSDTQKQFFLKPIKGRGYVDT
GKSVISEFYTPLVPKRYDFLGEIGKVIQKKQSEPVPHEVKGTGSDLL
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|57634611|ref|NC_002758.2|:c454403-453000 Staphylococcus aureus subsp. aureus Mu50 chromosome, complete genome
ATGCCATTGCTTCATGACAGAGGAGAGCGAATCAAAGCCAACGATAAGCACTTGGTCTATCATTTTGTAC
TAATTTCATTGCTGGTAGTTTTTCTAGTCGTCCTACTCCCTTTTCATTGGAGAGCGTTACAATCGGTGAA
CTGGCAAGCAGTTCAGTTAGATACATTTTTCTATCAACTTCATACGCCATACTTTTGGAGCAGTATTCTC
ACTGCTCTTTTTGTATGCGGACTTATCAGCTGGCTTTATTATCACTATCGTATAGATTCTATAAAACAGT
TAGAGCACCGTCAAAAGTTAGCTCGTATGATTTTAGAAAATCATTGGTATGAAGCCGAAGAAACTCAATC
AGAGGGATTCTTTAAAGATTTACCCAGCAAGAAAACCAAACAACGAATCCGCCATTTTCCTAAAATATAT
TATCGAATGAAAGATGGACTAATCCATATTCATGTAGAAATCACCTTAGGGAAATATCAAGATCAGCTTT
TGCACCTAGAAAACAAACTAGAAACAGGATTGTATTGTGAATTAGTGGAAAAAACGTTGAAAGATTCTTA
TGTAGAGTATGTCCTACTTTATGATACTATTGGCAATCGAATTGGCATTGAAGACGTGGTAGCTCAAGAT
GGACGTGTCAAATTGATGGAATCGGTCTATTGGGAGTTCGATTCTCTCCCTCACATGTTAATTGCTGGGG
GCACTGGTAGTGGAAAATCCTATTTTATTCTCACATTGATTGAATCTCTCCTGCATACAAATGCAAAGCT
TTATATTCTTGACCCTAAAAATGCTGATTTGGCAGACTTAGGGGCGGTCATGAATAATGTCTATTACCGT
AAAGAAGATATGTTGGCATGTATCAATCAATTTTACGAAGATATGATTGATCGCAGTGAAACCATGAAAC
AACACCCTAACTATAAAACAGGAGAAAATTATGCTTATCTTGGTTTGTCTGCCAATTTTCTTATTTTTGA
TGAATATGTGGCAATGATGGATATGCTAGGTCGTGAAAGTACCACCGTTATTCATAAACTCAAACAAATT
GTAATGTTAGGACGACAAGCAGGCTTCTTTTTAATTCTTGCCTGTCAACGTCCAGACGCAAAATATTTTA
GTGATGGGATTCGGGACAACTTTAACTTCCGTGTGGCTTTGGGTCGTATGTCTGAAATGGGCTTTGGTAT
GATGTTCGGAAGCGATACACAAAAACAATTTTTCTTAAAACCCATCAAGGGAAGAGGTTACGTGGATACA
GGAAAAAGTGTGATTAGTGAGTTTTATACACCCCTTGTACCAAAAAGGTACGATTTCTTAGGAGAAATAG
GAAAAGTCATTCAAAAAAAGCAATCTGAGCCTGTACCGCACGAAGTGAAAGGTACAGGTTCAGACTTGCT
TTGA
 Primer design