SecReT4
Protein ID: 160431630
T4SS name [ID]Trw [155]
Gene symboltraM
Locus tagMAK2.23
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK2 (NC_009980)
Repliconplasmid pMAK2 [GenBank: NC_009980] [Browse all T4SS(s) in this replicon]
Location [Strand]26688..26981 [+]
ProductTraM protein
Component typeTrwL
UniProt IDA8R715
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|160431630|ref|YP_001551797.1| TraM protein [Salmonella enterica subsp. enterica serovar Dublin]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASYLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|160431608|ref|NC_009980.1|:26688-26981 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK2, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCTCTGATTGGTATTGGTTCTGCATCATATCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design