SecReT4
Protein ID: 160431632
T4SS name [ID]Trw [155]
Gene symboltraC
Locus tagMAK2.26
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK2 (NC_009980)
Repliconplasmid pMAK2 [GenBank: NC_009980] [Browse all T4SS(s) in this replicon]
Location [Strand]29966..30679 [+]
ProductTraC protein
Component typeTrwJ
UniProt IDA8R717
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 5.9e-49, Aligned region: 25..216
Protein Sequence: 237 a.a.     [Download]
>gi|160431632|ref|YP_001551799.1| TraC protein [Salmonella enterica subsp. enterica serovar Dublin]
MKKSLTAVLLTTGLILGGAQSASAGIIVSNPTELIKQGEQLEQMAQQLEQLKSQLETQKNMYESMAKTTN
LGDLLGTSTNTLANNLPDNWKEVYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAIAYMNKKLAEKGA
YDRVMAEKAYNNQMQELSDMQALTEQIKSTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKL
LRAQKDRATRNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|160431608|ref|NC_009980.1|:29966-30679 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK2, complete sequence
ATGAAAAAATCACTTACGGCAGTGCTGCTGACCACCGGCTTGATTCTTGGGGGCGCGCAAAGCGCCTCCG
CTGGCATCATCGTATCCAACCCCACCGAGCTGATTAAACAGGGTGAACAGCTTGAACAAATGGCTCAACA
GCTGGAGCAGCTTAAAAGCCAGCTGGAGACGCAGAAAAATATGTATGAGTCGATGGCTAAAACAACCAAC
CTGGGCGATCTGCTGGGGACGTCAACCAATACGCTGGCGAATAACCTGCCTGACAACTGGAAAGAGGTGT
ACAGCGACGCGATGAACTCCAGTTCGTCGGTCACGCCTTCTGTTAACAGCATGATGGGCCAGTTTAATGC
TGAGGTTGACGACATGACGCCCAGCGAAGCAATCGCCTATATGAACAAAAAGCTGGCGGAAAAAGGTGCT
TACGACCGTGTGATGGCCGAAAAAGCCTACAACAACCAGATGCAAGAGCTGAGCGATATGCAGGCGCTGA
CGGAGCAGATTAAATCGACGCCAGACCTGAAATCCATTGCCGACCTGCAAGCACGTATCCAGACGTCACA
AGGCGCTATACAGGGTGAGCAGGCGAAGCTGAATTTGATGAATATGTTACAGCAATCGCAGGACAAACTT
TTGCGCGCACAGAAGGATCGTGCGACCCGTAATTTTGTTTTTGGAACCGGTGGGGACGTTACCGCGTCAC
CTTCAATTAACTGA
 Primer design