SecReT4
Protein ID: 160431635
T4SS name [ID]Trw [155]
Gene symboltraN
Locus tagMAK2.29
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK2 (NC_009980)
Repliconplasmid pMAK2 [GenBank: NC_009980] [Browse all T4SS(s) in this replicon]
Location [Strand]32053..32199 [+]
ProductTraN protein
Component typeTrwH
UniProt IDA8R720
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 48 a.a.     [Download]
>gi|160431635|ref|YP_001551802.1| TraN protein [Salmonella enterica subsp. enterica serovar Dublin]
MRSLLLMGVLLISACSSGHKPPPEPDWSNTVPVNKTIPVDTQGGANES
 
Nucleotide Sequence: 147 bp     [Download]
>gi|160431608|ref|NC_009980.1|:32053-32199 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK2, complete sequence
ATGCGCAGCTTATTGCTTATGGGAGTTCTTCTGATTAGCGCCTGTTCCAGCGGGCATAAACCGCCACCGG
AGCCGGACTGGAGCAACACCGTTCCAGTAAACAAAACAATCCCGGTTGATACGCAAGGTGGTGCAAATGA
AAGCTAA
 Primer design