SecReT4
Protein ID: 160431636
T4SS name [ID]Trw [155]
Gene symboltraE
Locus tagMAK2.30
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK2 (NC_009980)
Repliconplasmid pMAK2 [GenBank: NC_009980] [Browse all T4SS(s) in this replicon]
Location [Strand]32189..32887 [+]
ProductTraE protein
Component typeTrwG
UniProt IDA8R721
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9e-53, Aligned region: 24..230
Protein Sequence: 232 a.a.     [Download]
>gi|160431636|ref|YP_001551803.1| TraE protein [Salmonella enterica subsp. enterica serovar Dublin]
MKANKKTGLTREAIKEFNESRKGLEVDLMDEVLKSRRTAWMVATGSAVVTVFALSLVGYVVHKYSQPIPA
HLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNVAESYQSK
FKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEYKSLAMNA
EQRYVNPLGFRVTSYRVNPEVN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|160431608|ref|NC_009980.1|:32189-32887 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK2, complete sequence
ATGAAAGCTAATAAAAAAACAGGGCTTACACGTGAAGCCATTAAAGAGTTCAACGAAAGCCGTAAAGGGC
TTGAAGTTGATCTGATGGATGAAGTGCTGAAGTCCCGGCGTACCGCCTGGATGGTTGCCACCGGTTCAGC
GGTGGTAACTGTTTTTGCACTCTCTTTAGTTGGTTACGTAGTGCATAAGTACAGCCAGCCAATCCCCGCA
CATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGCTGACCCGCGACCAGACCTCTT
ATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCGTGAGAGCTATGACTTCTATTC
AGTTCAGGTCGACTATACGGCCGTTGGCTTAATGTCCACGCCGAACGTGGCAGAGTCTTACCAGAGCAAG
TTCAAGGGCCGCAATGGTCTTGATAAGGTTCTGGGCGACAGTGAAACGACCCGCGTGAAGATTAACTCTG
TGATCCTCGATAAACCGCACGGCGTAGCAACAATACGCTTTACTACGGTTCGCCGCGTGCGCAGCAATCC
CGTTGATGATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATATAAATCGCTGGCGATGAATGCT
GAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCGTCAACCCGGAAGTTAACTGA
 Primer design