SecReT4
Protein ID: 160431637
T4SS name [ID]Trw [155]
Gene symboltraO
Locus tagMAK2.31
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK2 (NC_009980)
Repliconplasmid pMAK2 [GenBank: NC_009980] [Browse all T4SS(s) in this replicon]
Location [Strand]32898..33782 [+]
ProductTraO protein
Component typeTrwF
UniProt IDA8R722
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.7e-57, Aligned region: 33..267
Protein Sequence: 294 a.a.     [Download]
>gi|160431637|ref|YP_001551804.1| TraO protein [Salmonella enterica subsp. enterica serovar Dublin]
MKKLLLSAVVLSVLGGAATNVMALEVGRNSPYDYRIKSVVYNPVNVVKIDAVAGVATHIVVAPDETYITH
AFGDSESWTFAHKMNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIETPWAVR
HAVLQLTYEYPFEQQEKAKSAADKKRITQKLKQTAFAGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFE
FPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNNFAPGAGAVATGT
ASPDVRRVQIGEDN
 
Nucleotide Sequence: 885 bp     [Download]
>gi|160431608|ref|NC_009980.1|:32898-33782 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK2, complete sequence
ATGAAAAAACTACTTCTTTCAGCAGTCGTTTTGTCAGTCCTGGGAGGCGCGGCCACTAACGTTATGGCGC
TTGAGGTTGGCCGCAATTCTCCTTATGACTATCGCATTAAAAGCGTTGTTTATAACCCTGTTAATGTGGT
CAAAATTGACGCTGTCGCCGGTGTGGCTACCCACATTGTTGTCGCGCCTGACGAAACCTATATCACTCAT
GCTTTTGGCGATTCTGAAAGCTGGACGTTTGCGCACAAAATGAACCATTTTTTTGTGAAGCCGAAACAGG
CCATGAGTGATACCAACCTGGTGATCGTCACCGATAAGCGCACCTATAACATCGTCCTCCATTTCATCGG
TGAAGAAACGAAGAAAAATGCAGACGGTACGGTATCAAAATCCTTTATTGAAACGCCGTGGGCTGTGCGC
CATGCCGTTCTTCAGCTGACCTATGAATATCCGTTTGAGCAGCAGGAAAAAGCCAAAAGCGCGGCTGATA
AAAAACGCATTACGCAGAAGCTGAAGCAGACGGCTTTTGCGGGGGCGAAGAACTATCAGTACGTAATGAG
CGAACAGCCTGAAATGCGCAGCATCCAGCCGGTTCACGTCTGGGATAACTACCGCTTTACCCGGTTTGAG
TTTCCGGCCAATGCGGAGTTACCGCAGGTCTACATGATCTCGGCCAGTGGCAAAGAAACGCTGCCTAACT
CTCATGTTGTGGGTGAGAACCGCAACATCATCGAGGTGGAAACCGTCGCTAAAGAGTGGCGTATTCGTCT
GGGCGATAAAGTCGTTGGCGTTCGTAATAATAATTTCGCGCCGGGCGCCGGTGCGGTAGCAACCGGTACG
GCTTCCCCGGATGTGCGCAGGGTTCAAATTGGGGAGGATAACTGA
 Primer design